DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG10274

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster


Alignment Length:515 Identity:105/515 - (20%)
Similarity:165/515 - (32%) Gaps:170/515 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQA--------QQHPKLS--HPC--F 128
            |.:|||:|::.....:||: .|...|..|..:.|...|...|        ..|.:||  |.|  .
  Fly   271 CHICHQKFKKAIRYEEHMK-HHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVD 334

  Fly   129 NCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSI--CTTAMLAA 191
            .|.:.|.....|..|               |..::||..|...|.:|.||:|..:  |..|:   
  Fly   335 GCGKTFPRIRLLTFH---------------MKKMHGITKAAAPPRDYPCTECEKVFRCPMAL--- 381

  Fly   192 GQQGFMEQQEAAVTP----------------DDQLPAMAPRDMRLTP------------------ 222
              :..|.:.:....|                .|.|...|.....:.|                  
  Fly   382 --KKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILT 444

  Fly   223 ------------EEQHHQQQLQAEH-----------------------H----HQQQHQQQQQ-- 246
                        |...|.:|..|.|                       |    |:..|..:::  
  Fly   445 HTQEKKFKCHICEHASHNKQSLANHIKIVHEKIKNYACQYCGKTFGKSHACKIHEMTHTGEKRCE 509

  Fly   247 -----------------QQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTV 294
                             .:..::.:|...:...|.|.:..:....|.|...|.....:.:.|:  
  Fly   510 CKVCGKKFLYPKSLTKHLKTHEKRVLRAIETYRQRQVEMGETPGEQFDNPPAPPVEGISIEPI-- 572

  Fly   295 KLNKNA----------NGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQA-NPGVPAPASSG 348
             :::||          :...|...|:.:.:.:...|  :|..||.:|..::.: :|.|......|
  Fly   573 -MSRNAADELLKVCAESVATIPKDPRRVQRVDLAQL--AGTAVNPIPSVSVPSWSPQVNFTKKEG 634

  Fly   349 VLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRK-IHTGEADATPKERPYTCSYCGKSFTQ 412
                            :|.||.|.:.|...|.:..|.| ||       .|.:.:.|.:|.|.|.:
  Fly   635 ----------------KHICPGCGQGFNNIGNMKRHYKIIH-------EKVKDFACRFCPKRFAK 676

  Fly   413 SNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSAL 472
            :.||:.|..||||||||.|..|...|..:..|.:|.|||....|...|   |.:..|..|
  Fly   677 AQTLRHHEWIHTGEKPFECKTCGTHFRQETALKRHQRTHENRPPVISP---KFYAAREEL 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 39/108 (36%)
C2H2 Zn finger 368..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 8/24 (33%)
C2H2 Zn finger 459..480 CDD:275368 4/14 (29%)
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 5/33 (15%)
C2H2 Zn finger 368..388 CDD:275368 6/24 (25%)
COG5048 394..729 CDD:227381 69/365 (19%)
C2H2 Zn finger 397..417 CDD:275368 2/19 (11%)
C2H2 Zn finger 425..445 CDD:275368 1/19 (5%)
C2H2 Zn finger 453..474 CDD:275368 5/20 (25%)
C2H2 Zn finger 482..502 CDD:275368 2/19 (11%)
C2H2 Zn finger 510..530 CDD:275368 0/19 (0%)
C2H2 Zn finger 638..659 CDD:275368 7/20 (35%)
C2H2 Zn finger 667..687 CDD:275368 7/19 (37%)
zf-H2C2_2 680..704 CDD:290200 13/23 (57%)
C2H2 Zn finger 695..715 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.