DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Blimp-1

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:548 Identity:127/548 - (23%)
Similarity:185/548 - (33%) Gaps:172/548 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QEQRLPRPEDQSPAPPPPPPSSATTSTAAPATPTHQVATVIANMDTLKTAFLPNLSMDPNVHVSP 73
            ||..||:.|::.....|.|.|      ..|:|.|                           |:..
  Fly   545 QEMSLPQEEEEDQVMHPEPDS------ICPSTTT---------------------------HLGD 576

  Fly    74 HYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATL------DGGHPQAQQHPKLSHPCFNCDE 132
            .:..|..::.||.:......:     ..|.|.|.:|:      .||  ||:....||.|.:..|.
  Fly   577 EHMLMMERERERERERIQERE-----PSNQQPASSTVIVLEHNSGG--QARTIVPLSKPYYEPDP 634

  Fly   133 ------KFGNAVD------LDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPN-------EYKCT 178
                  :||....      |...||| ....|..:.|...     ::||..|.       .||.:
  Fly   635 PGERYMRFGQPSSSILETILTSQHRL-EAAAAAANACRQA-----NAATPPPTSPTEMAYSYKKS 693

  Fly   179 Q--CGSICTTAMLAAGQQGFMEQQEAAVTPDDQL--PAMAPRDMRLTPEEQHHQQQL-------- 231
            |  ..::...:....||........|.|..:.::  ..|...:....|...||...:        
  Fly   694 QRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAA 758

  Fly   232 -----QAEHH--------------------HQQQHQQQQQQQQQQQ-----------ELLEQQQR 260
                 :|..|                    |...|.......:|..           .||:    
  Fly   759 YLGAGEAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQ---- 819

  Fly   261 EMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGD 325
                  ...|:.:|...|.|...|   ::.||.:                    ..|.|||..| 
  Fly   820 ------TSTQMLNHPLMQPLTPLQ---RLSPLRI--------------------SPPSSLSPDG- 854

  Fly   326 VVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAH---KIRHKCPDCPKTFKTPGTLAMHRKI 387
              ||.|      ..|.|...:|....|.:::|..|..   |:.::|..|.|||.....|.:|.:.
  Fly   855 --NSCP------RSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRT 911

  Fly   388 HTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHT 452
            |:|       |||:.|:.|.|||||...|::|..:||||||..|..|:|.||....|..|:|.|:
  Fly   912 HSG-------ERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHS 969

  Fly   453 GEKPYTCPYCDKRFTQRSALTVHTTKLH 480
            |:|||.|..|.::|||...|.:| .:||
  Fly   970 GQKPYACDLCPQKFTQFVHLKLH-KRLH 996

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 45/106 (42%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 11/24 (46%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/19 (37%)
zf-H2C2_2 904..929 CDD:290200 12/31 (39%)
C2H2 Zn finger 920..940 CDD:275368 9/19 (47%)
zf-H2C2_2 932..957 CDD:290200 12/24 (50%)
C2H2 Zn finger 948..968 CDD:275368 8/19 (42%)
zf-H2C2_2 960..985 CDD:290200 11/24 (46%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.