DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Kah

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:196 Identity:66/196 - (33%)
Similarity:89/196 - (45%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 HKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPY----------------------TCSYCGK 408
            |.||:|.|.:.|...||.||:.|....|...:..||                      .|.:|||
  Fly   119 HICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCECQFCGK 183

  Fly   409 SFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALT 473
            .|::...|:.|.|.|||||||.||.|||:|:.|..|..||:||:..||:||..|.|.|..:|.|.
  Fly   184 RFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLY 248

  Fly   474 VH--TTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGAPPPLSADTDTDPKKPSAAAAAS 536
            .|  ::.:... |.||.|      |.:...||:.|...........:||   ..|..|:||..|:
  Fly   249 KHEESSCMKNRGGVPGSG------AASGNRPPSSPKRQQAEVTSGTISA---LAPGSPAAAVCAA 304

  Fly   537 A 537
            :
  Fly   305 S 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 49/128 (38%)
C2H2 Zn finger 368..388 CDD:275368 9/19 (47%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 10/19 (53%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 7/22 (32%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 10/21 (48%)
C2H2 Zn finger 121..141 CDD:275368 9/19 (47%)
zf-C2H2 176..198 CDD:278523 8/21 (38%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 15/22 (68%)
zf-C2H2 204..226 CDD:278523 11/21 (52%)
C2H2 Zn finger 206..226 CDD:275368 10/19 (53%)
zf-H2C2_2 218..242 CDD:290200 11/23 (48%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.