DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Kr

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:423 Identity:103/423 - (24%)
Similarity:157/423 - (37%) Gaps:97/423 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VDLDEHHRLAHQTPAFLSRCLMCSIY---GIHSATQQPNEYKCTQCGSICTTAMLAAGQQ--GFM 197
            |.||....|:....|..|.....:||   |:..|.      ..:..|.:..|.:|||.:|  .||
  Fly    26 VHLDRSMSLSPPMSANTSATSAAAIYPAMGLQQAA------AASAFGMLSPTQLLAANRQAAAFM 84

  Fly   198 EQQEAAVTPDDQLP--------AMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQEL 254
            .|...:...:...|        |.|.:  :..|.:..|.....|..|..........:.......
  Fly    85 AQLPMSTLANTLFPHNPAALFGAWAAQ--QSLPPQGTHLHSPPASPHSPLSTPLGSGKHPLNSPN 147

  Fly   255 LEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNK--NANGGAIVSHPQVIIKEEP 317
            ...|..|..::|::..|....|.:             :::.:|.  :.:||             |
  Fly   148 STPQHHEPAKKARKLSVKKEFQTE-------------ISMSVNDMYHTSGG-------------P 186

  Fly   318 LSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLA 382
            :|...||...||       .:.|      :|...|...|..|.:......|..|.::|.....|.
  Fly   187 ISPPSSGSSPNS-------THDG------AGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQ 238

  Fly   383 MHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKH 447
            .|.:.|||       |:|:.|..|.|.||:.:.||.|.|:||||||:||.:|::.|.....|.:|
  Fly   239 NHERTHTG-------EKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRH 296

  Fly   448 IRTHTGEKPYTCPYCDKRFTQ----RSALTVHT--------------TKLHPLXGRPGGGRQLPV 494
            :|.||||:||||..||.:|:.    :|.:.||.              .:.|.| ....|.:    
  Fly   297 LRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHKCGIQ---- 357

  Fly   495 PAPAAPPPPTHPPNPSG--PGAPPPLSADTDTD 525
                :||.|...|..||  |.|...::.:..|:
  Fly   358 ----SPPTPALSPAMSGDYPVAISAIAIEASTN 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 44/110 (40%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 14/24 (58%)
C2H2 Zn finger 459..480 CDD:275368 7/38 (18%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 5/19 (26%)
zf-H2C2_2 237..261 CDD:290200 11/30 (37%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 13/23 (57%)
C2H2 Zn finger 308..328 CDD:275368 5/19 (26%)
zf-H2C2_2 321..345 CDD:290200 3/23 (13%)
C2H2 Zn finger 336..352 CDD:275368 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.