DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and rgr

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001163089.2 Gene:rgr / 35843 FlyBaseID:FBgn0267792 Length:889 Species:Drosophila melanogaster


Alignment Length:668 Identity:126/668 - (18%)
Similarity:203/668 - (30%) Gaps:245/668 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TTNPQEQRLPRPEDQSPAPPPPPPSSATTSTAAPA----------TPTHQ-VATVIANMDTLKTA 58
            |..|::..:......:| |.|.||:|.|:|||:.|          ...|: |..::...:..:..
  Fly   282 TGQPEKSAMELTPPATP-PTPLPPTSPTSSTASCADFQSKSRRELERNHEFVGCLLREYERTEKL 345

  Fly    59 FLPNLSMDPNVHVSPHYC----------------PMCHQQFERPQ--HVADHMQLCHGITLNAQG 105
            :.|.         .|.|.                .:||:|....:  .|...::..:...|....
  Fly   346 WNPR---------HPDYKYNAKRSAYGDLAGPLESICHRQLSGAEIFAVLKELRCRYRRELKKVN 401

  Fly   106 AIATLDGG--------------------HPQAQQHPKLSHPCFNCDEKFGNAVDLDEHHRLAHQT 150
            |:    ||                    :.:|::..|:|:.....::......|......|.|:.
  Fly   402 AL----GGKYKSRLWYFERMDFLRCVIENRRAEREAKISNESTESEKSCETDADSCGKSSLYHEV 462

  Fly   151 PAFL------SRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVTPDD- 208
            .:|:      ..||.           .|..|..|.|   |.|.:.........|:....::.:: 
  Fly   463 LSFILDAFKRQECLW-----------NPQHYDYTTC---CKTELFRDISVQLQEELNYELSGEEC 513

  Fly   209 -----QLPAMAPRDMR---------------------LTP--EEQ-------------------- 225
                 :|.....:::|                     |.|  :||                    
  Fly   514 CNEIQKLRTRYRKELRMVIKHKGLYLPKLWCYDEMEFLQPILQEQIFNKISKKIGVVGSNQKTKF 578

  Fly   226 ---------HHQQQLQ-AEHHHQQ------QHQQQQQQQQQQQEL----------------LEQQ 258
                     :.::||| .|.:|..      .|...:....:.|.|                .||.
  Fly   579 IDASSIRFDNTEKQLQFVEIYHNYSALWDVDHPDFRSNTYRSQALGQMLDEINTTFHTSYTAEQL 643

  Fly   259 QREM-----QEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNK--NANGGAIVSHPQVIIKEE 316
            ::.:     :..||::::....:|..        .:|.|..||.:  :.|.|             
  Fly   644 EKTLFNLRKEFSAQKRKILTESEDSS--------SIPLLHAKLAEFLDQNLG------------- 687

  Fly   317 PLSLSDSGDVVNSVPVYAIQ------ANPGVPAPASSGVLVGTQTVPADL-AHKIRHK------C 368
            |.......|:|.:...|.:.      ..|.:......|.     .:|.:| .|..||:      |
  Fly   688 PFRCDICSDLVKTCDQYKVHRSAHDGTQPFICTLCGKGF-----QMPCNLTVHIRRHRRDFPYSC 747

  Fly   369 PDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGY 433
            ..|.|.|.|...:|:|.:.|||       ||||.|..|||||...:....|.|.|..:..|||..
  Fly   748 EQCDKRFATSTEVAIHLRTHTG-------ERPYICDLCGKSFKTWSFFDIHRRRHLNQSTFHCPI 805

  Fly   434 CEKSFSVKDYLT----------------------------KHIRTHTGEKPYTCPYCDKRFTQRS 470
            |.|.|..|:..|                            ||...|...|.|.|..|.|||.|.:
  Fly   806 CAKGFYEKNRFTDHMNSHWAIRKHLCTVCGKTFTTYGNLKKHTELHLAVKKYKCGTCGKRFAQFA 870

  Fly   471 ALTVHTTKLHPLXGRPGG 488
            :|..|..:.|.. |:.||
  Fly   871 SLRWHKKREHSSVGQAGG 888

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 43/140 (31%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 8/47 (17%)
zf-H2C2_2 443..468 CDD:316026 11/52 (21%)
C2H2 Zn finger 459..480 CDD:275368 8/20 (40%)
rgrNP_001163089.2 MADF_DNA_bdg 335..420 CDD:287510 11/97 (11%)
MADF_DNA_bdg 465..551 CDD:287510 12/99 (12%)
MADF_DNA_bdg 595..682 CDD:287510 14/94 (15%)
C2H2 Zn finger 691..711 CDD:275368 3/19 (16%)
C2H2 Zn finger 719..739 CDD:275368 4/24 (17%)
zf-H2C2_2 731..756 CDD:290200 8/24 (33%)
COG5048 742..>824 CDD:227381 31/88 (35%)
C2H2 Zn finger 747..767 CDD:275368 7/19 (37%)
zf-H2C2_2 763..784 CDD:290200 14/27 (52%)
C2H2 Zn finger 775..795 CDD:275368 8/19 (42%)
C2H2 Zn finger 803..818 CDD:275368 5/14 (36%)
C2H2 Zn finger 831..851 CDD:275368 2/19 (11%)
C2H2 Zn finger 859..877 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.