DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Clamp

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001014498.1 Gene:Clamp / 35445 FlyBaseID:FBgn0032979 Length:566 Species:Drosophila melanogaster


Alignment Length:456 Identity:127/456 - (27%)
Similarity:177/456 - (38%) Gaps:111/456 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LCHGITLNAQGA---IATLDG-GHPQA--QQHP-------KLSHPCFNCDEKFGNAVDLDEHHRL 146
            |.:|:.|| |||   |||:|. |..|.  |..|       .:|..|..|.:.|.:...|:.|.|:
  Fly    85 LVNGMPLN-QGAALGIATVDAQGRIQIVNQNKPIAANTISNISFKCDVCSDMFPHLALLNAHKRM 148

  Fly   147 ----------AHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCG--SICTTAMLAAGQQGFMEQ 199
                      .|...|......:.|..|:   .|..|.....|.|  .|.::..|...||..|:|
  Fly   149 HTDGEQQQQQQHNAQAGGDSIAVVSAQGL---VQAQNIIGNGQMGQIQIVSSDTLEPVQQSVMQQ 210

  Fly   200 QEAAVTPDDQL---PAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQRE 261
            |:........:   .:|..:..|..|::...:..:|||           |..||||:|...|..:
  Fly   211 QQHESKASKCINCGSSMLQQSKRKGPKQVRCESCMQAE-----------QTAQQQQQLFVAQDGQ 264

  Fly   262 M-----------QEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKE 315
            |           |.|||.||:             ||.:....|.|...::..|   .||  :.|.
  Fly   265 MAHPVQIISTTPQAQAQLQQI-------------VAAQTGGTTPKREASSGSG---HHP--VKKR 311

  Fly   316 EPLSLSD----SGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTV----PAD------------- 359
            ....::.    :|..|..|..::..::.||.......|.|.|:.:    |:.             
  Fly   312 NSQQMTKCQKCNGSGVVLVGQHSHASHSGVGGSVKQSVTVKTECLSCRNPSKPFSCNICGGLFSR 376

  Fly   360 ----LAHKIRH------KCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSN 414
                .:||..|      ||..|...|.....|..|.:||||       |:||.|..||..|:||.
  Fly   377 YSSLWSHKKLHSGEKNYKCSICGLAFAKAVYLKNHARIHTG-------EKPYKCQTCGMQFSQSP 434

  Fly   415 TLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKL 479
            .||.|.|.|:||:|:.||.|:|.|:....|..|.|.|||||||.|..|...|:|.:.|..| .|:
  Fly   435 HLKNHERTHSGERPYVCGVCDKGFARHATLWNHRRIHTGEKPYKCEICGSAFSQAAHLKNH-AKV 498

  Fly   480 H 480
            |
  Fly   499 H 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 47/112 (42%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 10/19 (53%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 13/24 (54%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)
ClampNP_001014498.1 COG5048 <359..498 CDD:227381 52/146 (36%)
C2H2 Zn finger 367..387 CDD:275368 2/19 (11%)
zf-H2C2_2 379..403 CDD:290200 6/23 (26%)
C2H2 Zn finger 395..415 CDD:275368 5/19 (26%)
zf-H2C2_2 407..432 CDD:290200 13/31 (42%)
C2H2 Zn finger 423..443 CDD:275368 10/19 (53%)
zf-H2C2_2 435..460 CDD:290200 13/24 (54%)
C2H2 Zn finger 451..471 CDD:275368 8/19 (42%)
zf-H2C2_2 464..488 CDD:290200 13/23 (57%)
COG5048 475..>529 CDD:227381 11/26 (42%)
C2H2 Zn finger 479..499 CDD:275368 7/20 (35%)
zf-H2C2_2 491..515 CDD:290200 4/10 (40%)
C2H2 Zn finger 507..527 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.