DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and esg

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:518 Identity:112/518 - (21%)
Similarity:180/518 - (34%) Gaps:174/518 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VSPHY--CPM----CHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQ---------AQQH 120
            |..:|  ||:    .:.|||.||:        |..|.|           .||         .:::
  Fly     9 VEKNYSKCPLKKRPVNYQFEAPQN--------HSNTPN-----------EPQDLCVKKMEILEEN 54

  Fly   121 PKLSHPCFN---CDEKFGNAVD-LDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCG 181
            |  |....|   |.|..|..|| .|:.|.........:            .....||:   ||..
  Fly    55 P--SEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDV------------DVDSDPNQ---TQAA 102

  Fly   182 SICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTP---------EEQHHQ--------- 228
            ::...|.:||....      :.|.|....|.....:..::|         .:|.||         
  Fly   103 ALAAAAAVAAAAAA------SVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLI 161

  Fly   229 ---------QQLQAEHHHQQQHQQQQQQQQQQQELLEQ----QQREMQEQAQQ---------QQV 271
                     ..|....||....:........:.|::.:    :|.......|.         ...
  Fly   162 APSSPSDSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHT 226

  Fly   272 HHHQQDQDLAGDQVALKVPPLTVKLNKNA---------NGGAIVSHPQ-VIIKEEPLSLSDSGDV 326
            |||.              .|::...::|:         ......|.|: :.:|.:.|:|:     
  Fly   227 HHHH--------------APISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLN----- 272

  Fly   327 VNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHK-----IRHKCPDCPKTFKTPGTLAMHRK 386
            :|:       :.||..|.|.:|.: ..:|:|...|.|     .|::||||.|::.|...|..|::
  Fly   273 LNT-------SQPGEQAAAKTGDM-SPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQ 329

  Fly   387 IHTGEADATPKER--------------------------PYTCSYCGKSFTQSNTLKQHTRIHTG 425
            .|...|:....::                          |..|:.|||:|::...|:.|.|.|||
  Fly   330 FHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTG 394

  Fly   426 EKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPLXGRPGG 488
            ||||.|.:|.::|:.:..|..|::||:..|.|:|..|.|.|::.|.||.|:.      |.|||
  Fly   395 EKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSE-----GGCPGG 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/132 (30%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 443..468 CDD:316026 10/24 (42%)
C2H2 Zn finger 459..480 CDD:275368 8/20 (40%)
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 8/21 (38%)
C2H2 Zn finger 311..331 CDD:275370 8/19 (42%)
zf-C2H2 344..366 CDD:278523 0/21 (0%)
C2H2 Zn finger 346..366 CDD:275368 0/19 (0%)
zf-C2H2 370..392 CDD:278523 8/21 (38%)
C2H2 Zn finger 372..392 CDD:275368 8/19 (42%)
zf-H2C2_2 385..408 CDD:290200 12/22 (55%)
zf-C2H2 398..420 CDD:278523 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 428..444 CDD:275368 7/15 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I2624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.