DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and ZNF284

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001032902.1 Gene:ZNF284 / 342909 HGNCID:13078 Length:593 Species:Homo sapiens


Alignment Length:456 Identity:106/456 - (23%)
Similarity:148/456 - (32%) Gaps:156/456 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DTLKTAFLPN--LSMDPNVHV--SPHYCPMCHQQFERPQ--------HVADHMQLC--------H 97
            |....||..|  |.....:|.  .|..|..|.:.|.|..        |..:...:|        |
Human   206 DVCSKAFSQNSQLQTHQRIHTGEKPFKCEQCGKSFSRRSGMYVHCKLHTGEKPHICEECGKAFIH 270

  Fly    98 GITLNAQGAIATLDGGHPQAQQHPKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCS- 161
            ...|.....|.|  |..|         ..|:.|.:.|.:..:|:.|..:..|..:|  ||..|| 
Human   271 NSQLREHQRIHT--GEKP---------FKCYICGKSFHSRSNLNRHSMVHMQEKSF--RCDTCSN 322

  Fly   162 IYGIHSATQ-------QPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMR 219
            .:|..||..       :...|||.:||            :.|..:|:..                
Human   323 SFGQRSALNSHCMDHTKEKLYKCEECG------------RSFTCRQDLC---------------- 359

  Fly   220 LTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQ 284
                            .||..|   ...:.....:..:..|.....::.|:||:         .:
Human   360 ----------------KHQMDH---TGDKPYNCNVCGKGFRWSSCLSRHQRVHN---------GE 396

  Fly   285 VALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGV 349
            ...|......:...|:.|.   || |...:||.|                               
Human   397 TTFKCDGCGKRFYMNSQGH---SH-QRAYREEEL------------------------------- 426

  Fly   350 LVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSN 414
                            :||..|.|.:.:...|.:|:::|||       ||||.|..|||||..::
Human   427 ----------------YKCQKCGKGYISKFNLDLHQRVHTG-------ERPYNCKECGKSFRWAS 468

  Fly   415 TLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKL 479
            .:.:|.|:|||||||.|..|.|.|:....|..|.|.|||||||.|..|.|.|...|....| .:|
Human   469 GILRHKRLHTGEKPFKCEECGKRFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTH-QRL 532

  Fly   480 H 480
            |
Human   533 H 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 47/106 (44%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 14/24 (58%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
ZNF284NP_001032902.1 KRAB 8..67 CDD:214630
C2H2 Zn finger 152..169 CDD:275368
C2H2 Zn finger 177..197 CDD:275368
C2H2 Zn finger 205..225 CDD:275368 5/18 (28%)
COG5048 209..>554 CDD:227381 105/453 (23%)
C2H2 Zn finger 233..253 CDD:275368 4/19 (21%)
C2H2 Zn finger 261..281 CDD:275368 3/19 (16%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
C2H2 Zn finger 317..333 CDD:275368 6/15 (40%)
C2H2 Zn finger 345..365 CDD:275368 7/63 (11%)
C2H2 Zn finger 373..393 CDD:275368 2/19 (11%)
C2H2 Zn finger 401..419 CDD:275368 4/21 (19%)
C2H2 Zn finger 429..449 CDD:275368 5/19 (26%)
C2H2 Zn finger 457..477 CDD:275368 8/19 (42%)
C2H2 Zn finger 485..505 CDD:275368 7/19 (37%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.