Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260253.1 | Gene: | prg / 34177 | FlyBaseID: | FBgn0285971 | Length: | 558 | Species: | Drosophila melanogaster |
Alignment Length: | 296 | Identity: | 73/296 - (24%) |
---|---|---|---|
Similarity: | 109/296 - (36%) | Gaps: | 98/296 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 253 ELLEQ--------QQRE--MQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVS 307
Fly 308 HPQVII-----------KEEPLSLSDSGDVVN--------------------------SVPV--- 332
Fly 333 ---------YAIQANPGVPAPASSGVL----VGTQTVPADL-AHKIRHKCPDCP--------KTF 375
Fly 376 KTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSV 440
Fly 441 KDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHT 476 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 39/114 (34%) |
C2H2 Zn finger | 368..388 | CDD:275368 | 4/27 (15%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 443..468 | CDD:316026 | 12/24 (50%) | ||
C2H2 Zn finger | 459..480 | CDD:275368 | 5/18 (28%) | ||
prg | NP_001260253.1 | zf-AD | 16..94 | CDD:285071 | 7/21 (33%) |
COG5048 | <212..340 | CDD:227381 | 44/135 (33%) | ||
C2H2 Zn finger | 239..260 | CDD:275368 | 2/20 (10%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 280..305 | CDD:290200 | 14/24 (58%) | ||
zf-C2H2 | 294..316 | CDD:278523 | 12/21 (57%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 308..331 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 5/18 (28%) | ||
C2H2 Zn finger | 352..372 | CDD:275368 | |||
C2H2 Zn finger | 416..436 | CDD:275368 | |||
C2H2 Zn finger | 443..464 | CDD:275368 | |||
C2H2 Zn finger | 470..490 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |