DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG2202

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:498 Identity:104/498 - (20%)
Similarity:151/498 - (30%) Gaps:219/498 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PHYCPMCHQQFERPQHVADHMQLCHGITLN----AQGAIATLD-------------GGHPQAQQH 120
            ||.||.|.:.|.|..|:..|:|..|....:    .:.|.:.||             |..|.::..
  Fly   501 PHNCPHCPKAFARSDHLKAHVQSLHSNKEHKCSLCEAAFSRLDALERHKVSKHNGEGLEPGSELK 565

  Fly   121 PKLS-HPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSIC 184
            .:|: |.|..|.::|.:...| ..|.|.|..  ||                    |.|..|    
  Fly   566 LQLAEHTCEYCSKRFSSKTYL-RKHTLLHTD--FL--------------------YACKTC---- 603

  Fly   185 TTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQ 249
                                                                             
  Fly   604 ----------------------------------------------------------------- 603

  Fly   250 QQQELLEQQQREMQEQAQQQQVHHHQQD--QDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVI 312
                  ::..||..:..:.::.|..|::  ..:.||..| :...|.|.:.:: ||          
  Fly   604 ------DETFRERAQLREHEKTHTGQRNFLCCICGDSFA-RNDYLRVHMRRH-NG---------- 650

  Fly   313 IKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKT 377
              |:|                                                :||..|.|.|..
  Fly   651 --EKP------------------------------------------------YKCRFCVKAFPR 665

  Fly   378 PGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKD 442
            ...|.:|.:.|||       .:|..|:.|||||.::..|..|.|.||||:|:.|..|.|||:..:
  Fly   666 ATDLKVHERYHTG-------TKPNLCNTCGKSFHRAYNLTIHMRTHTGERPYKCDQCPKSFTQSN 723

  Fly   443 YLTKHIRTHTGEKPYTCPYCDKRFTQ-----RSALTVHTTKLHPLXGR--------PGGGRQLPV 494
            .|..|||.||||: |.||:||..|.|     ...::.|...:... ||        .||...|  
  Fly   724 DLKAHIRRHTGER-YKCPHCDAYFLQLYNMRNHCMSAHNKHIETKTGRLQRTGLLDDGGQSHL-- 785

  Fly   495 PAPAAPPPPTHPPNPSGPGAPPPLSADTDTDPKKPSAAAAASA 537
              .....||...||              :.||:..:.|||.:|
  Fly   786 --TTVVMPPARYPN--------------ELDPQLAATAAATAA 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 45/111 (41%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 9/19 (47%)
C2H2 Zn finger 431..451 CDD:275368 9/19 (47%)
zf-H2C2_2 443..468 CDD:316026 14/24 (58%)
C2H2 Zn finger 459..480 CDD:275368 7/25 (28%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 75/395 (19%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200 6/11 (55%)
C2H2 Zn finger 504..525 CDD:275368 8/20 (40%)
C2H2 Zn finger 532..548 CDD:275368 3/15 (20%)
C2H2 Zn finger 573..593 CDD:275368 6/20 (30%)
C2H2 Zn finger 600..620 CDD:275368 4/94 (4%)
zf-H2C2_2 613..637 CDD:290200 5/24 (21%)
C2H2 Zn finger 628..648 CDD:275368 5/20 (25%)
zf-H2C2_2 640..663 CDD:290200 10/83 (12%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
C2H2 Zn finger 684..704 CDD:275368 9/19 (47%)
zf-C2H2 684..704 CDD:278523 9/19 (47%)
zf-H2C2_2 696..721 CDD:290200 13/24 (54%)
C2H2 Zn finger 712..732 CDD:275368 9/19 (47%)
C2H2 Zn finger 739..755 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.