DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Sp1

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001259388.1 Gene:Sp1 / 31913 FlyBaseID:FBgn0020378 Length:726 Species:Drosophila melanogaster


Alignment Length:160 Identity:53/160 - (33%)
Similarity:75/160 - (46%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 NPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYT 402
            :|..|:|.|.....|..|.          .||:|.:..:. |...:|.:          |:..::
  Fly   343 SPSTPSPRSQRRYAGRATC----------DCPNCQEAERL-GPAGVHLR----------KKNIHS 386

  Fly   403 CSY--CGKSFTQSNTLKQHTRIHTGEKPFHCG--YCEKSFSVKDYLTKHIRTHTGEKPYTCPYCD 463
            |..  |||.:.:::.||.|.|.||||:||.|.  :|.|.|:..|.|.:|:|||||||.:.||.|:
  Fly   387 CHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCN 451

  Fly   464 KRFTQRSALTVHT-----TKLHPLXGRPGG 488
            |||.:...|..|.     |..|...|..||
  Fly   452 KRFMRSDHLAKHVKTHNGTANHQANGHNGG 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/110 (36%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 8/21 (38%)
C2H2 Zn finger 431..451 CDD:275368 8/21 (38%)
zf-H2C2_2 443..468 CDD:316026 15/24 (63%)
C2H2 Zn finger 459..480 CDD:275368 9/25 (36%)
Sp1NP_001259388.1 C2H2 Zn finger 390..409 CDD:275368 7/18 (39%)
zf-H2C2_2 401..428 CDD:290200 14/26 (54%)
C2H2 Zn finger 417..439 CDD:275368 8/21 (38%)
zf-H2C2_2 431..454 CDD:290200 13/22 (59%)
zf-C2H2 445..467 CDD:278523 8/21 (38%)
C2H2 Zn finger 447..467 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1951
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.