DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG42726

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:140 Identity:38/140 - (27%)
Similarity:59/140 - (42%) Gaps:23/140 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 RHKCPDCPKTFKTPGTLAMHRKIHT----------------GEADATPKERP-------YTCSYC 406
            :|.||.|.|.|:...:||.|..||:                .:|:.....|.       :.|..|
  Fly   155 KHLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVC 219

  Fly   407 GKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSA 471
            .|||.:..||:.|.:.|:..:...|..|.||::..|.|.:|:|.|...:.|.|..||....::..
  Fly   220 QKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDN 284

  Fly   472 LTVHTTKLHP 481
            :..|...:||
  Fly   285 MLRHLRSMHP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 35/129 (27%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 8/24 (33%)
C2H2 Zn finger 459..480 CDD:275368 4/20 (20%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
COG5048 <112..288 CDD:227381 35/132 (27%)
C2H2 Zn finger 131..151 CDD:275368
Chordopox_A33R 151..>254 CDD:283591 26/98 (27%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
C2H2 Zn finger 187..207 CDD:275368 2/19 (11%)
C2H2 Zn finger 216..236 CDD:275368 8/19 (42%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..290 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.