DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp280d

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001101635.2 Gene:Zfp280d / 315798 RGDID:1560796 Length:969 Species:Rattus norvegicus


Alignment Length:684 Identity:128/684 - (18%)
Similarity:203/684 - (29%) Gaps:220/684 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STTNPQEQRLPRPEDQSPAPPPPPPSSATTSTAAPATPTHQV-----ATVIANMDTLKTAFLPNL 63
            |:.||::   |:|.:....   ...||..:|..:|:..:.||     ....:|.....|.|    
  Rat   184 SSVNPKK---PKPNENISG---TDASSVVSSEKSPSVMSLQVVPSQGTNCSSNQSKNGTTF---- 238

  Fly    64 SMDPNVHVSPHYCPMCHQQFERPQHVADHMQLC--------HGIT----LNAQGAIATLDG---- 112
                     |..||.|:..|.....:.:||..|        .|:|    ||:.....|||.    
  Rat   239 ---------PRACPKCNIHFNLLDPLKNHMTYCCPDMINNFLGLTKTDNLNSANEAKTLDSEKGK 294

  Fly   113 --------------GHPQAQQHPKLSHPCFNCDEKFGNAVDLDEH--HRL-----------AHQT 150
                          |..|.:|....:..||:|.:...|.:....|  |.|           .|.|
  Rat   295 LIMLVNDFYYGKYEGDVQEEQKTHTTFKCFSCLKVLKNNIRFMNHMKHHLELEKQSSESWEKHTT 359

  Fly   151 PAFLSRC---------LMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAVTP 206
               ...|         |.|.|...|:    |:|:     .:||....|:...:..:.|.    ..
  Rat   360 ---CQHCYRQFPTPFQLQCHIESTHT----PHEF-----STICKICELSFETEQILLQH----MK 408

  Fly   207 DDQLPAMAP--------RDMRLTPEEQHHQQQLQAEH----------------------HHQQQH 241
            |:..|...|        |....:..|.|    .:..|                      ||..:|
  Rat   409 DNHKPGEMPYICQVCNYRSSLFSEVESH----FRTSHENTKNLLCPFCLKVIKIATPYMHHYMKH 469

  Fly   242 QQQQQQQQQQQELLEQQQREMQEQAQQQQVHHH-----QQDQDL-AGDQVALK--VPPLTVKLNK 298
            |::...:..:..|   |....:|:...:..||.     :|.:.| .|.:|.::  |.||      
  Rat   470 QKKGIHRCTKCRL---QFLTCKEKMDHKTQHHRTFVKPKQLEGLPPGTKVTIRASVAPL------ 525

  Fly   299 NANGGAIVSHPQVIIKEEPLSLS----DSGDVVNSVPVYAIQANPGVPAPASSGVLV--GTQTVP 357
              ..|:.|: |.:......|.||    ::....|.|.:.....|..:..|:.:..:.  |:::  
  Rat   526 --QSGSSVT-PSISASTSTLQLSPPRTENVTAKNHVKLNTSTPNTTISDPSKTNEIKSNGSKS-- 585

  Fly   358 ADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI 422
                 |.|.|..:..|...|........|::|...:...:...:.|..|.   ::......|...
  Rat   586 -----KNRSKVSNMQKKQSTLSNSNKKSKVNTALRNLRLRRGVHECIECS---SEVKDFANHFPT 642

  Fly   423 HTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKP------------------YTCPYC------- 462
            :.     ||.:|..:.|.......|:.:....:|                  ..|..|       
  Rat   643 YV-----HCSFCRYNTSCSKAYVNHMMSFHSNRPSKRYCIFKKHSENLRGISLVCLNCDFLTDVS 702

  Fly   463 --DKRFTQRSALTVHTTKL--------HPLXGRPGGGRQLPVPAP------AAPPPPTHPPNPSG 511
              |...|..|....||.::        .|. .|..   :|...||      .:.....|......
  Rat   703 GLDNMATHLSQHETHTCQVLVEKVSVCIPTSERLS---ELKTEAPTKGQESVSKETARHSTAERE 764

  Fly   512 PGA---------PPPLSADTDTDPKKPSAAAAAS 536
            |||         .||...||..|.....|||||:
  Rat   765 PGASHSESKQDKAPPSEDDTGRDASVCEAAAAAN 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 19/133 (14%)
C2H2 Zn finger 368..388 CDD:275368 3/19 (16%)
C2H2 Zn finger 403..423 CDD:275368 3/19 (16%)
C2H2 Zn finger 431..451 CDD:275368 4/19 (21%)
zf-H2C2_2 443..468 CDD:316026 5/51 (10%)
C2H2 Zn finger 459..480 CDD:275368 7/37 (19%)
Zfp280dNP_001101635.2 DUF4195 45..229 CDD:290548 11/50 (22%)
C2H2 Zn finger 323..357 CDD:275371 7/33 (21%)
C2H2 Zn finger 360..381 CDD:275368 4/20 (20%)
C2H2 Zn finger 390..411 CDD:275368 4/24 (17%)
C2H2 Zn finger 420..439 CDD:275368 3/22 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.