DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and CG12236

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_727050.1 Gene:CG12236 / 31523 FlyBaseID:FBgn0029822 Length:553 Species:Drosophila melanogaster


Alignment Length:423 Identity:94/423 - (22%)
Similarity:134/423 - (31%) Gaps:137/423 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LDEHHRLAHQTPAFLSRCLMCSIYGIHSATQQPNEYKCTQCGSICTTAMLAAGQQGFMEQQEAAV 204
            |...|:|....|:        :|..::...||.:  ...|..:...|..:.|..  .::...|:.
  Fly   130 LISEHKLIKTIPS--------TIRAVNEQQQQVS--NVAQAQTATQTIEIPAAT--LLQATNASQ 182

  Fly   205 TPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQ----QH---------QQQQQQQQQQQELLE 256
            .|...:.|.|........:.||.|||    |||.|    ||         |||||||||||:..:
  Fly   183 VPSQVVAAAAAAAAAQQLQVQHQQQQ----HHHVQTTQIQHIQVQSAPPPQQQQQQQQQQQQQQQ 243

  Fly   257 QQQREMQEQAQQQQVHHHQ--------------------------QDQD-----------LAGDQ 284
            |||::.|:|:||||....|                          .|.|           :..:|
  Fly   244 QQQQQQQQQSQQQQTTPVQTQHLTITNAVALPAASSVKKRKITFSDDDDNMYTTETVDYAVKDEQ 308

  Fly   285 VALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGD----------VVNSVPVYA----- 334
            ..:|...:|.     ..|...:..|..|:.|....|||...          ...:|..|:     
  Fly   309 TIVKTAEMTF-----LRGAVKMDIPDYIVGEVDDRLSDGATPQTSQDATTAAAQNVAQYSSEYEI 368

  Fly   335 ---------IQAN-----------------PGVPAPASSGVL---------VGTQTVPADLAHKI 364
                     .||:                 .|.|...|..|:         .|..|..:....|.
  Fly   369 LTESEMEEKYQADADNAEIAIEMTRLLGTASGTPGAGSGQVMEDSGGGSATTGPSTTVSVTQVKS 433

  Fly   365 RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKE------------RPYTCSYCGKSFTQSNTLK 417
            ..|........| ||::.:.|...:|...:.|..            .|..||:||:.....|.|:
  Fly   434 DSKASGTNAALK-PGSVTVARSSKSGATASAPPAGSDEESVQYTGLAPLNCSFCGRPLKSVNALR 497

  Fly   418 QHTRIHTGE---KPFHCGYCEKSFSVKDYLTKH 447
            :|......|   |...|..|.|||..|..|:.|
  Fly   498 RHIASRHSEIQGKEHECFICMKSFKTKWSLSTH 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 25/97 (26%)
C2H2 Zn finger 368..388 CDD:275368 4/19 (21%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 8/17 (47%)
zf-H2C2_2 443..468 CDD:316026 2/5 (40%)
C2H2 Zn finger 459..480 CDD:275368
CG12236NP_727050.1 BTB 22..116 CDD:279045
BTB 33..116 CDD:197585
Herpes_capsid <376..467 CDD:283714 16/91 (18%)
C2H2 Zn finger 483..512 CDD:275371 9/28 (32%)
C2H2 Zn finger 514..535 CDD:275371 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.