DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp521

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_038952847.1 Gene:Zfp521 / 307579 RGDID:1307345 Length:1321 Species:Rattus norvegicus


Alignment Length:192 Identity:56/192 - (29%)
Similarity:85/192 - (44%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SLSDSGDVVNSVPVYAIQANPGVPA--------PASSGVLVGTQTVPA-----DLAHK-----IR 365
            ||||    :....::..|...||..        |||| .....||.|:     |...:     :.
  Rat    58 SLSD----ITEHKIHQCQLTDGVDVEDDPTCSWPASS-PSSKDQTSPSHGEGCDFGEEEGGPGLP 117

  Fly   366 HKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFH 430
            :.|..|.|:|.....|..|.:.|:.:.       |:.|:||.:.|....:..:|.::|||:|.:|
  Rat   118 YPCQFCDKSFSRLSYLKHHEQSHSDKL-------PFKCTYCSRLFKHKRSRDRHIKLHTGDKKYH 175

  Fly   431 CGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPLX--GRPGGGR 490
            |..|:.:||..|:|..|::|||..|||.|..|.:.|...|:|..| .::|..   |...|.|
  Rat   176 CSECDAAFSRSDHLKIHLKTHTSNKPYKCAVCRRGFLSSSSLHGH-MQVHERSKDGSQSGSR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 35/106 (33%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 11/24 (46%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
Zfp521XP_038952847.1 COG5048 <84..236 CDD:227381 48/160 (30%)
C2H2 Zn finger 120..140 CDD:275368 6/19 (32%)
C2H2 Zn finger 148..168 CDD:275368 5/19 (26%)
C2H2 Zn finger 176..196 CDD:275368 7/19 (37%)
C2H2 Zn finger 204..224 CDD:275368 6/20 (30%)
C2H2 Zn finger 312..332 CDD:275368
C2H2 Zn finger 407..428 CDD:275368
C2H2 Zn finger 439..460 CDD:275368
C2H2 Zn finger 479..498 CDD:275368
C2H2 Zn finger 636..656 CDD:275368
C2H2 Zn finger 666..686 CDD:275368
C2H2 Zn finger 696..713 CDD:275368
C2H2 Zn finger 724..745 CDD:275368
C2H2 Zn finger 754..774 CDD:275368
COG5236 785..>964 CDD:227561
C2H2 Zn finger 785..805 CDD:275368
C2H2 Zn finger 811..829 CDD:275368
C2H2 Zn finger 888..909 CDD:275368
C2H2 Zn finger 932..952 CDD:275368
C2H2 Zn finger 961..981 CDD:275368
C2H2 Zn finger 1228..1248 CDD:275368
C2H2 Zn finger 1259..1280 CDD:275368
C2H2 Zn finger 1289..1305 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.