DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Fezf2

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001100721.1 Gene:Fezf2 / 305719 RGDID:1311068 Length:455 Species:Rattus norvegicus


Alignment Length:240 Identity:73/240 - (30%)
Similarity:95/240 - (39%) Gaps:60/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 PLTVKLNKN----ANGGAIVSHPQVIIKEEPLSLSDS----------GDVVNS-------VPVYA 334
            ||...|.:|    |..|.:.||.::     |...:||          |.|.|:       :||:.
  Rat   236 PLEQVLKENSALTAERGGVKSHSKL-----PGGSTDSKPKNFTCEVCGKVFNAHYNLTRHMPVHT 295

  Fly   335 IQANPGVPAPASSGV----------LVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHT 389
             .|.|.|......|.          ::.||..|        |||..|.|.|....||..|.:||.
  Rat   296 -GARPFVCKVCGKGFRQASTLCRHKIIHTQEKP--------HKCNQCGKAFNRSSTLNTHIRIHA 351

  Fly   390 GEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 454
            |       .:|:.|.:|||.|.|....|.|...|:|||.:.|..|.|:|.....||.|:.||..:
  Rat   352 G-------YKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQYKCTICNKAFHQVYNLTFHMHTHNDK 409

  Fly   455 KPYTCPYCDKRFTQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAA 499
            ||:||..|.|.|.:...|..|..|||.. |        |...|:|
  Rat   410 KPFTCATCGKGFCRNFDLKKHVRKLHDSVG--------PTATPSA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 41/106 (39%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 7/20 (35%)
Fezf2NP_001100721.1 C2H2 Zn finger 274..294 CDD:275368 4/19 (21%)
COG5048 <284..>390 CDD:227381 35/121 (29%)
C2H2 Zn finger 302..322 CDD:275368 1/19 (5%)
zf-H2C2_2 317..339 CDD:404364 9/29 (31%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)
C2H2 Zn finger 358..378 CDD:275368 8/19 (42%)
SFP1 <380..436 CDD:227516 23/55 (42%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
C2H2 Zn finger 414..432 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.