DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp280c

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_006257603.1 Gene:Zfp280c / 302812 RGDID:1564669 Length:753 Species:Rattus norvegicus


Alignment Length:567 Identity:98/567 - (17%)
Similarity:161/567 - (28%) Gaps:199/567 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSTTNPQEQRLPRPEDQ-----SPAPPPPPPS-------SATTSTAAPATPTHQVATVIANMDTL 55
            |||...|..||..|...     :|..|....|       ||::...:|:..:.||  |::||:  
  Rat   175 KSTGVNQTLRLKHPSSSKVNSVNPKKPKTNASISETGRGSASSLNMSPSEASSQV--VLSNMN-- 235

  Fly    56 KTAFLPNLSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQH 120
             |:.:.:.:..|::    ..||.|:.:|.....:..||:.|....:|.  .:.||...:.:|   
  Rat   236 -TSSIQSAAGKPSL----RSCPKCNVKFSLLDPLKCHMKRCCPDMINK--FLETLKSENSKA--- 290

  Fly   121 PKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHSAT-----QQPNEYKCTQC 180
              :|......|::           :|......|        .||.|..|     :.|..:||..|
  Rat   291 --VSRAIIGSDKE-----------KLIMLVSDF--------YYGRHEGTIEEDQKAPTTFKCFSC 334

  Fly   181 GSICTTAMLAAGQQGFMEQQEAAVTPDDQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQ 245
            ..:                              ...::|.....:||.:       .::|:.:..
  Rat   335 TKV------------------------------LKNNIRFMNHMKHHLE-------FEKQNNETW 362

  Fly   246 QQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQ 310
            :.....|....|.....|.|...:..|                                      
  Rat   363 ESHTTCQHCYRQYPNPFQLQCHIESTH-------------------------------------- 389

  Fly   311 VIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTF 375
                                                             ..|.....|..|..:|
  Rat   390 -------------------------------------------------TPHDFSTICKICELSF 405

  Fly   376 KTPGTLAMHRK-IHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTR-IHTGEKPFHCGYCEKSF 438
            :|...|..|.| .|      .|.|.||.|..|....:..:.::.|.| .|...|...|.:|.|..
  Rat   406 ETEHLLLQHMKDTH------KPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFCLKVS 464

  Fly   439 SVKDYLTKHIRTHTGEKPYTCPYCDKRF-TQRSAL---TVHTTKLHP--LXGRPGGGRQLPVPA- 496
            .:......|...|..:..|.||.|..:| |.:..:   ..|.|.:.|  | |.| .|.::.:.| 
  Rat   465 RMATPYMNHYMRHQKKGIYRCPKCRLQFLTSKEKIDHKLEHRTFIKPKELEGLP-PGTKVTIRAS 528

  Fly   497 -------PAAPPPPTHPPNPSGPGAPPPLSADTDTDPKKPSAAAAAS 536
                   .::||..|.|........|...:..|.....|.::..:|:
  Rat   529 LGSIQSRSSSPPSSTIPSTSLQLSVPKSKTTTTKNTTTKNNSKVSAN 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 29/112 (26%)
C2H2 Zn finger 368..388 CDD:275368 7/20 (35%)
C2H2 Zn finger 403..423 CDD:275368 4/20 (20%)
C2H2 Zn finger 431..451 CDD:275368 4/19 (21%)
zf-H2C2_2 443..468 CDD:316026 7/25 (28%)
C2H2 Zn finger 459..480 CDD:275368 7/24 (29%)
Zfp280cXP_006257603.1 DUF4195 62..237 CDD:404681 18/66 (27%)
C2H2 Zn finger 368..389 CDD:275368 4/20 (20%)
C2H2 Zn finger 398..419 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..446 CDD:275368 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.