DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp280b

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001099854.1 Gene:Zfp280b / 294343 RGDID:1565460 Length:532 Species:Rattus norvegicus


Alignment Length:217 Identity:59/217 - (27%)
Similarity:81/217 - (37%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 ALKVPPLTVKLNKNANGGAIVS---HPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGV--PAPA 345
            :|:.|.   .||...||..:..   ||:          .|||.|...   ::..|:|..  |...
  Rat   219 SLEAPK---SLNLFVNGAPLSGDPVHPR----------QDSGSVDTD---FSSLASPETFDPKKG 267

  Fly   346 SSGVLVGT--------QTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIH-----TGEADATPK 397
            |..:|:..        :..|....| ...|||.|.|..|.. ....|.|.|     .|..:|.  
  Rat   268 SLTLLLSDFYYGQYKGEGKPEQKTH-TTFKCPSCSKALKNV-KFMNHTKHHLELERQGSDEAW-- 328

  Fly   398 ERPYTCSYCGKSFTQSNTLKQH-TRIHTGEKP-FHCGYCEKSFSVKDYLTKHIRTH--TGEKPYT 458
            |...||..|.:.|.....|:.| .|:||...| ..|..||.||..:..|.:|::.:  .||.||.
  Rat   329 ESHTTCLRCHRLFASPFQLECHIDRVHTAPDPCVVCKICELSFETEQVLLEHMKDNHKPGEMPYV 393

  Fly   459 CPYCDKRFTQRSALTVHTTKLH 480
            |..|..|.:..:.:..|.||.|
  Rat   394 CQVCKYRSSVFADVETHFTKCH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 36/115 (31%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 6/20 (30%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 9/26 (35%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
Zfp280bNP_001099854.1 DUF4195 52..219 CDD:404681 59/217 (27%)
C2H2 Zn finger 334..355 CDD:275368 6/20 (30%)
C2H2 Zn finger 364..385 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.