DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp507

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001099718.2 Gene:Zfp507 / 292816 RGDID:1307017 Length:937 Species:Rattus norvegicus


Alignment Length:333 Identity:61/333 - (18%)
Similarity:110/333 - (33%) Gaps:88/333 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 QQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVP----PLTVKL--NKNA 300
            :::..|.....::|    :|:|:.||.|.    ..|..|.|..|...:|    |...:|  ..:.
  Rat   580 RERTDQNASDDDIL----KELQDNAQCQP----NSDGSLLGSNVVEYIPDAERPYRCRLCNYSSG 636

  Fly   301 NGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIR 365
            |.|.|..|.:|..:.:|..                       .|....:...::.:.:.:.:..:
  Rat   637 NRGYIKQHLRVHRQRQPYQ-----------------------CPICEHIAENSKDLESHMINHCK 678

  Fly   366 ---HKCPDCPKTFKTPGTLAMHRK---------------------------IHTGEADATPKERP 400
               |:|..|.::|.....|..|.:                           :..|...:|.|:  
  Rat   679 TRIHQCKQCKESFHYKSQLRNHEREQHCMPNTLSVASNEPRISRDATDGKCVQEGNKSSTQKQ-- 741

  Fly   401 YTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKR 465
            |.|..|..:.|....::.|.|||..:||:.|..|....|....|..|:..|..::.|.....:| 
  Rat   742 YRCDVCDYTSTTYVGVRNHRRIHNSDKPYRCSLCGYVCSHPPSLKSHMWKHASDQNYNYEQVNK- 805

  Fly   466 FTQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGP--GAPPPLSADTDTDPKK 528
                 |:....::...: |:..|           .|..|.....:||  |:|..|.:.::...:.
  Rat   806 -----AINDAISQSGRVLGKSRG-----------KPLLTSSEERTGPTTGSPENLVSSSELSSQL 854

  Fly   529 PSAAAAAS 536
            |.....||
  Rat   855 PGDGIDAS 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 28/133 (21%)
C2H2 Zn finger 368..388 CDD:275368 5/46 (11%)
C2H2 Zn finger 403..423 CDD:275368 5/19 (26%)
C2H2 Zn finger 431..451 CDD:275368 5/19 (26%)
zf-H2C2_2 443..468 CDD:316026 5/24 (21%)
C2H2 Zn finger 459..480 CDD:275368 2/20 (10%)
Zfp507NP_001099718.2 C2H2 Zn finger 628..648 CDD:275368 5/19 (26%)
C2H2 Zn finger 656..676 CDD:275368 1/19 (5%)
C2H2 Zn finger 684..705 CDD:275368 5/20 (25%)
C2H2 Zn finger 744..764 CDD:275368 5/19 (26%)
C2H2 Zn finger 772..792 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.