DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cf2 and ZBTB38

DIOPT Version :9

Sequence 1:	NP_001350854.1	Gene:	Cf2 / 33692	FlyBaseID:	FBgn0000286	Length:	537	Species:	Drosophila melanogaster
Sequence 2:	XP_005247313.1	Gene:	ZBTB38 / 253461	HGNCID:	26636	Length:	1196	Species:	Homo sapiens

Alignment Length:	110	Identity:	47/110 - (42%)
Similarity:	62/110 - (56%)	Gaps:	7/110 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   366 HKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFH 430
            :.|..|.|.|::|.||.||.:.|||       |:||.|..||:.|:....|::|.|||.|.|.|.
Human  1011 YACELCAKQFQSPSTLKMHMRCHTG-------EKPYQCKTCGRCFSVQGNLQKHERIHLGLKEFV 1068

  Fly   431 CGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475
            |.||.|:|::.:.|..|.|.|||||.|.|.:|.:||...|....|
Human  1069 CQYCNKAFTLNETLKIHERIHTGEKRYHCQFCFQRFLYLSTKRNH 1113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cf2	NP_001350854.1	COG5048	<366..>473	CDD:227381	46/106 (43%)
		C2H2 Zn finger	368..388	CDD:275368	9/19 (47%)
		C2H2 Zn finger	403..423	CDD:275368	7/19 (37%)
		C2H2 Zn finger	431..451	CDD:275368	8/19 (42%)
		zf-H2C2_2	443..468	CDD:316026	13/24 (54%)
		C2H2 Zn finger	459..480	CDD:275368	6/17 (35%)
ZBTB38	XP_005247313.1	BTB	24..123	CDD:279045
		BTB	35..131	CDD:197585
		C2H2 Zn finger	345..365	CDD:275368
		C2H2 Zn finger	374..393	CDD:275368
		C2H2 Zn finger	463..483	CDD:275368
		C2H2 Zn finger	491..511	CDD:275368
		C2H2 Zn finger	519..537	CDD:275368
		C2H2 Zn finger	1013..1033	CDD:275368	9/19 (47%)
		zf-H2C2_2	1026..1049	CDD:290200	12/29 (41%)
		zf-C2H2	1039..1061	CDD:278523	8/21 (38%)
		C2H2 Zn finger	1041..1061	CDD:275368	7/19 (37%)
		zf-H2C2_2	1053..1077	CDD:290200	12/23 (52%)
		C2H2 Zn finger	1069..1089	CDD:275368	8/19 (42%)
		zf-H2C2_2	1082..1106	CDD:290200	13/23 (57%)
		C2H2 Zn finger	1097..1121	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24388
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100