| Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036010907.1 | Gene: | Zbtb38 / 245007 | MGIID: | 2442866 | Length: | 1243 | Species: | Mus musculus |
| Alignment Length: | 225 | Identity: | 61/225 - (27%) |
|---|---|---|---|
| Similarity: | 94/225 - (41%) | Gaps: | 41/225 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 257 QQQREM------QEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKE 315
Fly 316 EPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGT 380
Fly 381 LAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLT 445
Fly 446 KHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 44/106 (42%) |
| C2H2 Zn finger | 368..388 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 403..423 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 431..451 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 443..468 | CDD:316026 | 12/24 (50%) | ||
| C2H2 Zn finger | 459..480 | CDD:275368 | 5/17 (29%) | ||
| Zbtb38 | XP_036010907.1 | BTB_POZ_ZBTB38_CIBZ | 61..174 | CDD:349532 | |
| zf-C2H2_8 | <386..446 | CDD:406359 | |||
| C2H2 Zn finger | 388..408 | CDD:275368 | |||
| C2H2 Zn finger | 417..436 | CDD:275368 | |||
| C2H2 Zn finger | 506..526 | CDD:275368 | |||
| C2H2 Zn finger | 534..554 | CDD:275368 | |||
| C2H2 Zn finger | 562..580 | CDD:275368 | |||
| C2H2 Zn finger | 1061..1081 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 1074..1097 | CDD:404364 | 12/29 (41%) | ||
| zf-C2H2 | 1087..1109 | CDD:395048 | 8/21 (38%) | ||
| C2H2 Zn finger | 1089..1109 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 1117..1137 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 1145..1165 | CDD:275368 | 5/17 (29%) | ||
| C2H2 Zn finger | 1176..1196 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24388 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||