DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp280d

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_666336.3 Gene:Zfp280d / 235469 MGIID:2384583 Length:974 Species:Mus musculus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:65/201 - (32%) Gaps:40/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIH--TGEKPFH 430
            |..|.:.|.||..|..|.     |:..||.|....|..|..||.....|.||.:.:  .||.|:.
Mouse   372 CQHCYRQFPTPFQLQCHI-----ESTHTPHEFSTICKICELSFETEQILLQHMKDNHKPGEMPYI 431

  Fly   431 CGYCEKSFSVKDYLTKHIRT-HTGEKPYTCPYCDK----------------------------RF 466
            |..|....|:...:..|.|| |...|...||:|.|                            :|
Mouse   432 CQVCNYRSSLFSEVESHFRTSHENTKNLLCPFCLKVIKIATPYMHHYMKHQKKGIHRCTKCRLQF 496

  Fly   467 TQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGAPPPLSADTDT---DPKK 528
            ........|.|:.|.. .:|.....|| |........:..|..||....|.:|..|.|   .|.:
Mouse   497 LTCKEKMDHKTQHHRTFVKPKQLEGLP-PGTKVTIRASVGPLQSGSSVTPSISPSTSTLQLSPPE 560

  Fly   529 PSAAAA 534
            |....|
Mouse   561 PDNVTA 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 34/135 (25%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 6/20 (30%)
zf-H2C2_2 443..468 CDD:316026 10/53 (19%)
C2H2 Zn finger 459..480 CDD:275368 7/48 (15%)
Zfp280dNP_666336.3 DUF4195 57..241 CDD:290548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..216
C2H2 Zn finger 335..369 CDD:275371
C2H2 Zn finger 372..393 CDD:275368 8/25 (32%)
C2H2 Zn finger 402..423 CDD:275368 7/20 (35%)
C2H2 Zn finger 432..451 CDD:275368 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..624 16/61 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 751..797
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 815..974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.