Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666336.3 | Gene: | Zfp280d / 235469 | MGIID: | 2384583 | Length: | 974 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 65/201 - (32%) | Gaps: | 40/201 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 368 CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIH--TGEKPFH 430
Fly 431 CGYCEKSFSVKDYLTKHIRT-HTGEKPYTCPYCDK----------------------------RF 466
Fly 467 TQRSALTVHTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGAPPPLSADTDT---DPKK 528
Fly 529 PSAAAA 534 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 34/135 (25%) |
C2H2 Zn finger | 368..388 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 403..423 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 443..468 | CDD:316026 | 10/53 (19%) | ||
C2H2 Zn finger | 459..480 | CDD:275368 | 7/48 (15%) | ||
Zfp280d | NP_666336.3 | DUF4195 | 57..241 | CDD:290548 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 188..216 | ||||
C2H2 Zn finger | 335..369 | CDD:275371 | |||
C2H2 Zn finger | 372..393 | CDD:275368 | 8/25 (32%) | ||
C2H2 Zn finger | 402..423 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 432..451 | CDD:275368 | 4/18 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 507..624 | 16/61 (26%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 751..797 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 815..974 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |