DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and ZNF281

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001268222.1 Gene:ZNF281 / 23528 HGNCID:13075 Length:895 Species:Homo sapiens


Alignment Length:327 Identity:80/327 - (24%)
Similarity:115/327 - (35%) Gaps:109/327 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 AAGQQGFMEQQ------EAAVTPDDQLPAMAPRDMRLTPEEQ--HHQQQLQAEHHHQ-------- 238
            ||....|..|:      ::.|:...:.||        .||||  ||..    .|||.        
Human   105 AASAAAFPSQRTSWGFLQSLVSIKQEKPA--------DPEEQQSHHHH----HHHHYGGLFAGAE 157

  Fly   239 -----------------------QQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDL 280
                                   .||.|||..|..:..||....|.......::.    :||.::
Human   158 ERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSSSRTDDHHGTEEP----KQDTNV 218

  Fly   281 AGDQVALKVPPLT--VKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPA 343
               :.|.:..|.:  :|..:..:..   |.|.::           ||                  
Human   219 ---KKAKRPKPESQGIKAKRKPSAS---SKPSLV-----------GD------------------ 248

  Fly   344 PASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGK 408
              ..|.::.....|        |.|..|...|::...|..|..||||       |||:.||.|..
Human   249 --GEGAILSPSQKP--------HICDHCSAAFRSSYHLRRHVLIHTG-------ERPFQCSQCSM 296

  Fly   409 SFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALT 473
            .|.|...|::|.:||:.||||.|..|...|..|.::.:|.|||:|||||.|..|.:.|::...|.
Human   297 GFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLL 361

  Fly   474 VH 475
            .|
Human   362 KH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 42/106 (40%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
C2H2 Zn finger 403..423 CDD:275368 7/19 (37%)
C2H2 Zn finger 431..451 CDD:275368 6/19 (32%)
zf-H2C2_2 443..468 CDD:316026 12/24 (50%)
C2H2 Zn finger 459..480 CDD:275368 5/17 (29%)
ZNF281NP_001268222.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..113 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149 10/30 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..253 18/110 (16%)
C2H2 Zn finger 263..283 CDD:275368 5/19 (26%)
zf-H2C2_2 275..300 CDD:316026 13/31 (42%)
C2H2 Zn finger 291..311 CDD:275368 7/19 (37%)
zf-H2C2_2 304..328 CDD:316026 11/23 (48%)
C2H2 Zn finger 319..339 CDD:275368 6/19 (32%)
zf-H2C2_2 331..356 CDD:316026 12/24 (50%)
C2H2 Zn finger 347..366 CDD:275368 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..660
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.