DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and Zfp341

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_955008.2 Gene:Zfp341 / 228807 MGIID:2682937 Length:846 Species:Mus musculus


Alignment Length:689 Identity:148/689 - (21%)
Similarity:213/689 - (30%) Gaps:224/689 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TTNPQEQRLPRPEDQSPAPPPPPPSSATTS---------------TAAPATPTHQVATVIANMDT 54
            |..|.....|.|....|.||||||.:...|               .|||......|......|..
Mouse   176 TQPPPPPPPPPPLPPPPQPPPPPPQTLGPSGRSNPVGNSVVEVYNAAAPMAGNGTVEIQALGMQP 240

  Fly    55 LKTAFLPNLSMDPNVHVSPHYCPMCHQQF--ERPQHVADHMQLCHGITLNAQGA-IATLD----- 111
            .....:|:..::..|:.:|.......|:|  :.|...|.        ..||.|: :||.|     
Mouse   241 YPPLEVPSQCVEAPVYPTPPVYSPGKQEFKPKGPSSTAP--------MTNATGSTVATFDSPPTL 297

  Fly   112 --------GGHPQAQQHPKLSH-PCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSIYGIHS 167
                    .|.|:|...||... .|..||:.|....||.:|.|.......|  :|:.|.    .:
Mouse   298 KTRRAKGASGLPEAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPF--QCIACG----RA 356

  Fly   168 ATQQPNEYKCTQCGSI-------------CTTAMLAAGQQGFMEQQE-------AAVTPDDQLPA 212
            ..|:.|..|..|...:             ..|..:.|......|:::       ::.|....||.
Mouse   357 FAQKSNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPNRQEEEDTGLGQSLSSTTQPQALPT 421

  Fly   213 MAPRD-----------------MRLTPEEQHHQQQLQAEHHHQQQHQQQQ---------QQQQQQ 251
            ....:                 .:..|.:.....||::   |..||:::|         .|...:
Mouse   422 AGEDEGDKPEAKQVVLIDSSYLCQFCPSKFSTYFQLKS---HMIQHKKEQVYKCVVKSCAQMFPK 483

  Fly   252 QELLEQQQREMQEQAQQQQVHHHQQD----QDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVI 312
            .:...:..|..||:. ..:.|...:|    .||...|.:..:.|                     
Mouse   484 LDTFLEHIRSHQEEL-SYRCHLCSKDFPSLYDLGVHQYSHSLLP--------------------- 526

  Fly   313 IKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKI------------- 364
             :..|...|.....|..|..|:      .|......|...|.:.|.....|:             
Mouse   527 -QHSPKKDSTVYKCVKCVNKYS------TPEALEHHVQTATHSFPCPHCQKVFPCERYLRRHLPT 584

  Fly   365 -----RHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI-- 422
                 |.:|..|.|.|:....|.:|..||:|       |:||.||.|..:|.:.:.||:|..|  
Mouse   585 HGSGGRFRCQICKKFFRKEHYLKLHAHIHSG-------EKPYKCSVCESAFNRKDKLKRHMLIHE 642

  Fly   423 -------------------------------HTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKP 456
                                           |.|.|...||.|.||||.:.:|.:|.|.|||...
Mouse   643 PFKKYKCPFSMHTGCSKEFNRQDKLKAHILSHAGLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYK 707

  Fly   457 YTCPYCDKRFTQRSALTVHTTKLHPL------XGRP--------GGG-------RQLPVPAP--- 497
            :.|..|.|.|::...|..|..:|.|.      ..||        |||       .:.|:|.|   
Mouse   708 FRCAGCAKGFSRHKYLKDHRCRLGPTKDKDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGL 772

  Fly   498 ----AAPPPPTHPPNPSGPGAPP-----PLSADTDTDPK 527
                ||.|.|     .:.||.||     .||.....||:
Mouse   773 EELKAAGPSP-----EAAPGKPPFEQDAVLSIVVGGDPE 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 40/139 (29%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 8/52 (15%)
C2H2 Zn finger 431..451 CDD:275368 10/19 (53%)
zf-H2C2_2 443..468 CDD:316026 10/24 (42%)
C2H2 Zn finger 459..480 CDD:275368 6/20 (30%)
Zfp341NP_955008.2 COG5048 321..726 CDD:227381 90/449 (20%)
zf-C2H2 321..342 CDD:278523 8/20 (40%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
zf-H2C2_2 334..359 CDD:290200 7/30 (23%)
C2H2 Zn finger 350..370 CDD:275368 6/23 (26%)
C2H2 Zn finger 444..464 CDD:275368 4/22 (18%)
C2H2 Zn finger 472..494 CDD:275368 2/21 (10%)
C2H2 Zn finger 502..522 CDD:275368 5/19 (26%)
C2H2 Zn finger 539..561 CDD:275370 5/27 (19%)
C2H2 Zn finger 565..585 CDD:275368 1/19 (5%)
C2H2 Zn finger 593..613 CDD:275368 6/19 (32%)
zf-H2C2_2 605..630 CDD:290200 12/31 (39%)
C2H2 Zn finger 621..641 CDD:275368 7/19 (37%)
C2H2 Zn finger 649..674 CDD:275368 0/24 (0%)
C2H2 Zn finger 682..702 CDD:275368 10/19 (53%)
C2H2 Zn finger 710..727 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.