| Sequence 1: | NP_001350854.1 | Gene: | Cf2 / 33692 | FlyBaseID: | FBgn0000286 | Length: | 537 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_542778.2 | Gene: | ZNF280A / 129025 | HGNCID: | 18597 | Length: | 542 | Species: | Homo sapiens |
| Alignment Length: | 199 | Identity: | 48/199 - (24%) |
|---|---|---|---|
| Similarity: | 62/199 - (31%) | Gaps: | 39/199 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 368 CPDCPKTFKTPGTLAMH-RKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIH--TGEKPF 429
Fly 430 HCGYCEKSFSVKDYLTKHIRT-HTGEKPYTCPYCDK-------------RFTQRSALTV------ 474
Fly 475 ---------HTTKLHPLXGRPGGGRQLPVPAPAAPPPPTHPPNPSGPGAPPPLSADTDTDPKKPS 530
Fly 531 AAAA 534 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cf2 | NP_001350854.1 | COG5048 | <366..>473 | CDD:227381 | 33/121 (27%) |
| C2H2 Zn finger | 368..388 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 403..423 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 431..451 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 443..468 | CDD:316026 | 9/38 (24%) | ||
| C2H2 Zn finger | 459..480 | CDD:275368 | 9/48 (19%) | ||
| ZNF280A | NP_542778.2 | DUF4195 | 47..217 | CDD:316361 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 105..185 | ||||
| C2H2 Zn finger | 336..357 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 366..386 | CDD:275368 | 7/19 (37%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 502..542 | 6/26 (23%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24388 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||