DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cf2 and si:cabz01069022.1

DIOPT Version :9

Sequence 1:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_017211315.1 Gene:si:cabz01069022.1 / 100332864 ZFINID:ZDB-GENE-161017-86 Length:313 Species:Danio rerio


Alignment Length:153 Identity:55/153 - (35%)
Similarity:69/153 - (45%) Gaps:25/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 HKIRHK------CPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHT 420
            |.:.|.      |..|.|:|...|.|.:|.::|||       |:|:||..||.||.|...:.:|.
Zfish   173 HMVVHNSENTFTCQQCGKSFNRKGNLKVHMRVHTG-------EKPFTCQQCGISFAQKGGIDEHM 230

  Fly   421 RIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPLXGR 485
            |:|||.|.|.|..|..||:.|..|..|:|.||||.||||..|...|..::.|..|....|.. |.
Zfish   231 RLHTGVKTFICPECGVSFTRKGNLKVHMRIHTGENPYTCQQCGMSFILKATLKRHIRTQHVESGS 295

  Fly   486 PGGGRQLPVPAPAAPPPPTHPPN 508
            |            |.....|.||
Zfish   296 P------------ASTAERHSPN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 45/112 (40%)
C2H2 Zn finger 368..388 CDD:275368 7/19 (37%)
C2H2 Zn finger 403..423 CDD:275368 8/19 (42%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 13/24 (54%)
C2H2 Zn finger 459..480 CDD:275368 5/20 (25%)
si:cabz01069022.1XP_017211315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.