DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and MRP4

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_011859.1 Gene:MRP4 / 856384 SGDID:S000000996 Length:394 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:67/231 - (29%)
Similarity:98/231 - (42%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ALVEQRILKHPDYF--QVHNLFTVRDLFNARVHYGHKEGSLDDRMRPYLFGSRLGHLIFDLDKTA 101
            |.:.:....|.|.|  .:....||..|.:|.||.|..........:.|::|...|..|.||::|.
Yeast   162 ATISKVYYPHKDIFYPPLPENITVESLMSAGVHLGQSTSLWRSSTQSYIYGEYKGIHIIDLNQTL 226

  Fly   102 SHLRDALNFAAHIAFRDGIILFF-NRNAMNSHLVERKAQEAGEFSHTRFWRGGIFTNA------- 158
            |:|:.|......::...|||||. .|......|.|...:..|.:..|| |..|..||:       
Yeast   227 SYLKRAAKVVEGVSESGGIILFLGTRQGQKRGLEEAAKKTHGYYVSTR-WIPGTLTNSTEISGIW 290

  Fly   159 -NVQFDAVTR---------------LPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNCN 207
             ..:.|:...               .|||.:.||...|    ..|:.:|.|..:|||.|:|::..
Yeast   291 EKQEIDSNDNPTERALSPNETSKQVKPDLLVVLNPTEN----RNALLEAIKSRVPTIAIIDTDSE 351

  Fly   208 PNLITYPVPGNDDSPAAVELYCNLFKEAILRGKRER 243
            |:|:|||:||||||..:|.....:...|..||.:.|
Yeast   352 PSLVTYPIPGNDDSLRSVNFLLGVLARAGQRGLQNR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 58/198 (29%)
MRP4NP_011859.1 Ribosomal_S2 188..383 CDD:395251 58/199 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I1589
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - oto98982
orthoMCL 1 0.900 - - OOG6_101759
Panther 1 1.100 - - LDO PTHR12534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1256
SonicParanoid 1 1.000 - - X3526
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.