DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and RPS0A

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_011730.1 Gene:RPS0A / 853128 SGDID:S000003446 Length:252 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:46/204 - (22%)
Similarity:82/204 - (40%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LFNARVHYGHKEGSLDDRMRPYLFGSRL-GHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNR 126
            |..|..|.|.:  ::.....||:|.:|. |..:.::.||...|..|....|.|...:.::...:|
Yeast    17 LLAANTHLGAR--NVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSR 79

  Fly   127 NAMNSHLVERKAQE-----AGEFSHTRFWRGGIFTNANVQFDAVTRL---PDLCIFLNTQNNVMA 183
            ......:::..|..     ||.|:      .|.|||      .:||.   |.|.|..:.:::.. 
Yeast    80 TFGQRAVLKFAAHTGATPIAGRFT------PGSFTN------YITRSFKEPRLVIVTDPRSDAQ- 131

  Fly   184 QHTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGNDDSPAAVELYCNLFKEAILRGKRERRQLLG 248
               |:::|:.:.||.|.:.|.:.....:...:|.|:....::.|...|....:||       |.|
Yeast   132 ---AIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLR-------LRG 186

  Fly   249 LPPLDESQP 257
             ..:|.:||
Yeast   187 -ALVDRTQP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 39/183 (21%)
RPS0ANP_011730.1 PTZ00254 1..252 CDD:240331 46/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.