DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and rps2

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_051048.1 Gene:rps2 / 844786 -ID:- Length:236 Species:Arabidopsis thaliana


Alignment Length:224 Identity:61/224 - (27%)
Similarity:93/224 - (41%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VRDLFNARVHYGHKEGSLDDRMRPYLFGSRLGHLIFDLDKTASHLRDALNFAAHIAFRDGIILFF 124
            :.::..|.||:||.....:.||.||:...|.|..|.:|.:||..|.:|.:.....|.|....|..
plant    10 LEEMMRAGVHFGHGTRKWNPRMAPYISAKRKGIHIINLTRTARFLSEACDLVFDAASRGKQFLIV 74

  Fly   125 NRNAMNSHLVERKAQEAGEFSHTRFWRGGIFTNANV------------------------QFDA- 164
            ......:.||.|.|..|......:.|.||:.||.:.                        :.|| 
plant    75 GTKNKAADLVSRAAIRARCHYVNKKWLGGMLTNWSTTEKRLHKFRDLRTEQKTEGFNRLPKRDAA 139

  Fly   165 ------------------VTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNCNPNLI 211
                              :|.|||:.|.|:.|.    ::||:|:...:.||||.::|:||||:|.
plant   140 VLKRQLSRLETYLGGIKYMTGLPDIVIILDQQE----EYTALRECITLGIPTISLIDTNCNPDLA 200

  Fly   212 TYPVPGNDDSPAAVELYCNLFKEAILRGK 240
            ...:|.|||:.|::....|....||..|:
plant   201 DISIPANDDAIASIRFILNKLVFAICEGR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 60/217 (28%)
rps2NP_051048.1 rps2 1..230 CDD:177007 61/224 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I2363
OMA 1 1.010 - - QHG62495
OrthoDB 1 1.010 - - D573006at2759
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - oto2859
orthoMCL 1 0.900 - - OOG6_101759
Panther 1 1.100 - - LDO PTHR12534
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.