DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and mrps2

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001074162.1 Gene:mrps2 / 791211 ZFINID:ZDB-GENE-070112-992 Length:264 Species:Danio rerio


Alignment Length:217 Identity:122/217 - (56%)
Similarity:160/217 - (73%) Gaps:2/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SVETEPEDIALVEQRILKHPDYFQVHNLFTVRDLFNARVHYGHKEGSLDDRMRPYLFGSRLGHLI 94
            ::||:..|..|  ...|..||||.:..||:::|||:||||.|||:|.....|.|||||.||...|
Zfish    44 TIETDATDKIL--NFPLTQPDYFHLSELFSMKDLFDARVHLGHKKGCRHALMEPYLFGCRLDMDI 106

  Fly    95 FDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAMNSHLVERKAQEAGEFSHTRFWRGGIFTNAN 159
            .||::|..||:.||||.||:|||.|::||.:|....:||||..|::.||::|||:|:||:.|||.
Zfish   107 IDLEQTVDHLQRALNFTAHVAFRGGVVLFVSRRRQFAHLVETTARDCGEYAHTRYWKGGLLTNAP 171

  Fly   160 VQFDAVTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGNDDSPAA 224
            :|::...|||||.:||:|.|||..:|..:||||||.|||:|||||||||:||:||||||||:|||
Zfish   172 IQYNPGVRLPDLIVFLSTLNNVFREHVGIRDAAKMNIPTVGIVDSNCNPSLISYPVPGNDDTPAA 236

  Fly   225 VELYCNLFKEAILRGKRERRQL 246
            :||||.|||..|.|.|.:|||:
Zfish   237 MELYCRLFKMTIKRAKDKRRQM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 105/174 (60%)
mrps2NP_001074162.1 RPS2 75..250 CDD:100106 105/174 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587902
Domainoid 1 1.000 118 1.000 Domainoid score I5832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H99837
Inparanoid 1 1.050 259 1.000 Inparanoid score I3119
OMA 1 1.010 - - QHG62495
OrthoDB 1 1.010 - - D437653at33208
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - oto41465
orthoMCL 1 0.900 - - OOG6_101759
Panther 1 1.100 - - LDO PTHR12534
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.