DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and mrps2

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001016765.1 Gene:mrps2 / 549519 XenbaseID:XB-GENE-493893 Length:280 Species:Xenopus tropicalis


Alignment Length:222 Identity:126/222 - (56%)
Similarity:160/222 - (72%) Gaps:5/222 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQSVETEPEDIA---LVEQRILKHPDYFQVHNLFTVRDLFNARVHYGHKEGSLDDRMRPYLFGSR 89
            :|..|..|.|..   |||.  |||||:|.|..||::|:|:::|||.|||:|.....|.|||||.|
 Frog    48 QQHPEPSPADFTQKLLVEP--LKHPDFFNVKELFSLRELYDSRVHLGHKKGCRHRLMEPYLFGCR 110

  Fly    90 LGHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAMNSHLVERKAQEAGEFSHTRFWRGGI 154
            |...|.|||:|..||:.|||..||||:|.|:|||.:||...|||:|..|::.||::|||:|:||:
 Frog   111 LEQDIIDLDQTMRHLQLALNVTAHIAYRKGVILFVSRNRQFSHLIESTARDCGEYAHTRYWQGGL 175

  Fly   155 FTNANVQFDAVTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGND 219
            .|||.||:.|..|||||.:||:|.|.|..||.|:||||||.|||:|:||:||||.|||||:||||
 Frog   176 LTNAPVQYGAGVRLPDLIVFLSTLNTVFEQHVAIRDAAKMNIPTVGVVDTNCNPGLITYPIPGND 240

  Fly   220 DSPAAVELYCNLFKEAILRGKRERRQL 246
            ||..|:||||.|||..|.|.|.:|:|:
 Frog   241 DSAPAMELYCRLFKMTINRAKEKRKQM 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 105/174 (60%)
mrps2NP_001016765.1 RPS2 84..259 CDD:100106 105/174 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6068
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H99837
Inparanoid 1 1.050 260 1.000 Inparanoid score I3030
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D437653at33208
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - otm47510
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1256
SonicParanoid 1 1.000 - - X3526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.