DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and MRPS2

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001358330.1 Gene:MRPS2 / 51116 HGNCID:14495 Length:296 Species:Homo sapiens


Alignment Length:226 Identity:129/226 - (57%)
Similarity:159/226 - (70%) Gaps:10/226 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 STQPEQSVETEPEDIALVEQRILKHPDYFQVHNLFTVRDLFNARVHYGHKEGSLDDRMRPYLFGS 88
            ||.....:..||          |||.|:|.|..||:||.||:||||.|||.|.....|.||:|||
Human    55 STDFNDKILNEP----------LKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGS 109

  Fly    89 RLGHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAMNSHLVERKAQEAGEFSHTRFWRGG 153
            ||.|.|.||::||:||:.||||.||:|:|.|||||.:||...|:|:|..|::.||::|||::|||
Human   110 RLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGG 174

  Fly   154 IFTNANVQFDAVTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGN 218
            :.|||.:.|....|||||.|||:|.||:...|.||||||||.|||:||||:||||.|||||||||
Human   175 MLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGN 239

  Fly   219 DDSPAAVELYCNLFKEAILRGKRERRQLLGL 249
            ||||.||.|||.||:.||.|.|.:|:|:..|
Human   240 DDSPLAVHLYCRLFQTAITRAKEKRQQVEAL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 110/174 (63%)
MRPS2NP_001358330.1 RPS2 84..259 CDD:100106 110/174 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..296
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152933
Domainoid 1 1.000 121 1.000 Domainoid score I5734
eggNOG 1 0.900 - - E1_COG0052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H99837
Inparanoid 1 1.050 259 1.000 Inparanoid score I3127
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62495
OrthoDB 1 1.010 - - D437653at33208
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - oto88423
orthoMCL 1 0.900 - - OOG6_101759
Panther 1 1.100 - - LDO PTHR12534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1256
SonicParanoid 1 1.000 - - X3526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.