DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and RPSA

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001291217.1 Gene:RPSA / 3921 HGNCID:6502 Length:300 Species:Homo sapiens


Alignment Length:184 Identity:40/184 - (21%)
Similarity:70/184 - (38%) Gaps:26/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ARVHYGHKEGSLDDRMRPYLFGSRL-GHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRN-- 127
            |..|.|..  :||.:|..|::..:. |..|.:|.:|...|..|......|.....:.:..:||  
Human    21 AGTHLGGT--NLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTG 83

  Fly   128 --------AMNSHLVERKAQEAGEFSHTRFWRGGIFTNANVQFDAVTRLPDLCIFLNTQNNVMAQ 184
                    .:...........||.|:      .|.|||   |..|..|.|.|.:..:.:    |.
Human    84 QVCGTVRAVLKFAAATGATPIAGRFT------PGTFTN---QIQAAFREPRLLVVTDPR----AD 135

  Fly   185 HTAVRDAAKMAIPTIGIVDSNCNPNLITYPVPGNDDSPAAVELYCNLFKEAILR 238
            |..:.:|:.:.:|||.:.:::.....:...:|.|:....:|.|...:....:||
Human   136 HQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 38/182 (21%)
RPSANP_001291217.1 PTZ00254 1..255 CDD:240331 40/184 (22%)
Laminin-binding 166..185 4/18 (22%)
Laminin-binding 210..234
[DE]-W-[ST] 1 235..237
Laminin-binding 247..300
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..300
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.