DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS2 and mrps-2

DIOPT Version :9

Sequence 1:NP_523473.2 Gene:mRpS2 / 33688 FlyBaseID:FBgn0031639 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_505180.1 Gene:mrps-2 / 179229 WormBaseID:WBGene00020718 Length:264 Species:Caenorhabditis elegans


Alignment Length:234 Identity:98/234 - (41%)
Similarity:137/234 - (58%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 STQPEQSVETEPEDIAL----VEQRILK--------HPDYFQVHNLFTVRDLFNARVHYGHKEGS 76
            ||....||   |:...|    |:..:||        |.|.|....:..:.::|.||:|||||.|:
 Worm    29 STSSSSSV---PDRATLEKGTVQPTVLKPFVSASLQHEDLFNFEKMVHIDEMFKARLHYGHKVGT 90

  Fly    77 LDDRMRPYLFGSRLGHLIFDLDKTASHLRDALNFAAHIAFRDGIILFFNRNAMNSHLVERKAQEA 141
            :::.|:..|:|.|||..:||||.|..:|..||||.||::.|.|:|||...|......||:.|.|.
 Worm    91 VNNNMKWALYGERLGVCLFDLDITKKYLVRALNFVAHVSLRGGMILFVTSNRDTMFDVEKAADEV 155

  Fly   142 GEFSHTRFWRGGIFTNANVQFDAVTRLPDLCIFLNTQNNVMAQHTAVRDAAKMAIPTIGIVDSNC 206
            |::||.|.|:.|..||......|..||||...||:|..::...|.|:.:||||||||||:||||.
 Worm   156 GQYSHVRKWQSGTLTNTRQLLGASVRLPDAVCFLSTLTSLGENHPAIVEAAKMAIPTIGVVDSNS 220

  Fly   207 NPNLITYPVPGNDDSPAAVELYCNLFKEAILRGKRERRQ 245
            :|..:||.||.|||:|.:.|....:||||:.:|:.||::
 Worm   221 DPAYLTYLVPANDDTPQSTEYLLRMFKEAVRKGQEERKR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS2NP_523473.2 RPS2 63..238 CDD:100106 83/174 (48%)
mrps-2NP_505180.1 RPS2 77..252 CDD:100106 83/174 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162643
Domainoid 1 1.000 96 1.000 Domainoid score I4617
eggNOG 1 0.900 - - E1_COG0052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H99837
Inparanoid 1 1.050 187 1.000 Inparanoid score I2597
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62495
OrthoDB 1 1.010 - - D437653at33208
OrthoFinder 1 1.000 - - FOG0002724
OrthoInspector 1 1.000 - - oto19187
orthoMCL 1 0.900 - - OOG6_101759
Panther 1 1.100 - - LDO PTHR12534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1256
SonicParanoid 1 1.000 - - X3526
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.