DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mxt and mxt-1

DIOPT Version :10

Sequence 1:NP_001162874.1 Gene:mxt / 33686 FlyBaseID:FBgn0031637 Length:775 Species:Drosophila melanogaster
Sequence 2:NP_493246.1 Gene:mxt-1 / 173151 WormBaseID:WBGene00012478 Length:507 Species:Caenorhabditis elegans


Alignment Length:224 Identity:45/224 - (20%)
Similarity:79/224 - (35%) Gaps:82/224 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RRLPSTTVGQCFTLVRSFTGGITQWAKKAEQL------------ESEEP-----------AAEEL 46
            :||.:::||:             .|.::..||            |:..|           .|.|.
 Worm   138 QRLKTSSVGE-------------MWQQENSQLSRRRSRSFDNAFENSSPDYLPFEFRALEIALEA 189

  Fly    47 PLTFVDDDAESTEAR--------EARIAAL------RNKSRL------LPQHRNMLHGVLPYEQS 91
            ..||:|..|...|..        .::|:.|      |.||||      :.:.|:.:..::..:..
 Worm   190 ACTFLDSQASELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQKVRDEIEQLMDDDGD 254

  Fly    92 QSWIHDTVKYKRM---------MLGRYGIDGSKVDPRVCFPTKKEAYERAEYERVAFPFSLKQMM 147
            .:.::.|.|.:||         :||....||..|.              |....|:.|...::: 
 Worm   255 MAEMYLTEKKRRMEGSMYGDQSLLGYRSNDGLSVS--------------APVSPVSSPPDSRRL- 304

  Fly   148 DANESERKARKAQIEAREAEVARKLEKLD 176
              ::|...||.....||.:|.|..:|:|:
 Worm   305 --DKSLSIARSRHDSARSSEGAENIEELE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mxtNP_001162874.1 KH-I_Mextli_like 225..296 CDD:411882
mxt-1NP_493246.1 KH-I_Mextli_like 240..311 CDD:411882 14/87 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.