DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tank and EI24

DIOPT Version :9

Sequence 1:NP_608864.1 Gene:tank / 33684 FlyBaseID:FBgn0031635 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_004870.3 Gene:EI24 / 9538 HGNCID:13276 Length:340 Species:Homo sapiens


Alignment Length:349 Identity:135/349 - (38%)
Similarity:197/349 - (56%) Gaps:50/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKNITLGILYGLWDSIRGMTLVLHIDDEVNRQNAEQEHRQQLRRTDKDRYERARRSPSPVPSSA 67
            ::|.....:..|:.|||.|:..:..:|..:.::..||               |.||:     ||.
Human     4 SVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQ---------------RRRRA-----SSV 48

  Fly    68 AAMIREEYAKQAEENADERTLEKILGKKPAAQDQHPQGEKKIAKKLFKCCMLNGGFTWLSIVLFE 132
            .|..|.:..::.:|:                       |.:|..::|:||..|||..|.|::||.
Human    49 LAQRRAQSIERKQES-----------------------EPRIVSRIFQCCAWNGGVFWFSLLLFY 90

  Fly   133 NALLPTLKFCLTIFYG---AHSETLPVVWGWLHPILSLLFGMMWVLPIFMLSKIVSSLWFADIAN 194
            ...:|.|:.......|   .|.:    ||.||...|:.:|..:||||:|:|||:|:::||.|||:
Human    91 RVFIPVLQSVTARIIGDPSLHGD----VWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIAD 151

  Fly   195 AAYRVRKGRPQLIPGISKLVADFLFSMVVQMLFLVQSMLVNLVPVKYVGSSLCFVHLCLLYSLYS 259
            .|:.|...:|...|.:||::||.||::::|.|||:|.|.|:|.|:..||..:..:|:.||||||.
Human   152 LAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYC 216

  Fly   260 FEYKWFNMGWELHRRLTYIEKNWPYFFGFGIPLTVLTNLSSSVIVSSCIFSIFFPLFILSGNEAK 324
            |||:|||.|.|:|:||:.||:||||:||||:||..||.:.||.|:|.|:|||.|||||:|.||||
Human   217 FEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAK 281

  Fly   325 PIVDTTEVSLRLFSPVVFISNLCF 348
            .........|||||.|||:||..|
Human   282 TPGKAYLFQLRLFSLVVFLSNRLF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tankNP_608864.1 EI24 164..296 CDD:284638 67/131 (51%)
EI24NP_004870.3 EI24 120..254 CDD:311296 68/133 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148280
Domainoid 1 1.000 200 1.000 Domainoid score I3045
eggNOG 1 0.900 - - E1_KOG3966
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3588
Inparanoid 1 1.050 256 1.000 Inparanoid score I3175
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55407
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005680
OrthoInspector 1 1.000 - - oto90172
orthoMCL 1 0.900 - - OOG6_104073
Panther 1 1.100 - - LDO PTHR21389
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2509
SonicParanoid 1 1.000 - - X4663
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.