DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tank and AT4G06676

DIOPT Version :9

Sequence 1:NP_608864.1 Gene:tank / 33684 FlyBaseID:FBgn0031635 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_849325.4 Gene:AT4G06676 / 826112 AraportID:AT4G06676 Length:320 Species:Arabidopsis thaliana


Alignment Length:257 Identity:73/257 - (28%)
Similarity:125/257 - (48%) Gaps:51/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KKIAKKLFKCCMLNGGFTWLSIVLFENALLPTL--------------KFCLTIFYGAHSETLPVV 157
            :|:..:..:|.:|||.....|:.:|:..:.|:|              :||   .||.       .
plant    33 RKLLLRTGQCFLLNGLIFLGSLGVFKWFIDPSLQWILPDQCSPLTSQEFC---SYGG-------F 87

  Fly   158 WGWLHPILSLLFGMMWVLPIFMLSKIVSSLWFADIA------------NAAYRVRKG-------- 202
            :.:|...|..||.:.|..|::|||.|:|::|:.|||            |:|..:|:|        
plant    88 YAFLRGGLLQLFYVFWFYPLYMLSFILSNIWYNDIAKHGFEAIEISDLNSAEALRQGEALASLNM 152

  Fly   203 ----RPQLIPGISKLVADFLFSMVVQMLFLVQSMLVNLVPVKYVGSSLCFVHLCLLYSLYSFEYK 263
                ||..:.|:...:.:.::|:::...|.::..:|.::|  |:|..|.|:.|..:|:.|.:|||
plant   153 ANAERPSGLGGVMIGIGEQVYSILLLTFFFLEVCVVGVIP--YIGKILNFLLLSWMYAYYCYEYK 215

  Fly   264 WFNMGWELHRRLTYIEKNWPYFFGFGIPLTVLTNLSSSVIVSSCIFSIFFPLFILSGNEAKP 325
            |...|..|.:||.:.:.||.:|.|||.| .||.....|.:||..:.:|.||||:|:...:.|
plant   216 WNFSGISLKKRLDFFQSNWAFFAGFGSP-CVLAIFFLSPLVSGALMAILFPLFVLTATGSGP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tankNP_608864.1 EI24 164..296 CDD:284638 48/155 (31%)
AT4G06676NP_849325.4 EI24 98..255 CDD:399918 49/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2762
eggNOG 1 0.900 - - E1_KOG3966
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55407
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005680
OrthoInspector 1 1.000 - - oto3682
orthoMCL 1 0.900 - - OOG6_104073
Panther 1 1.100 - - LDO PTHR21389
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.