DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tank and Ei24

DIOPT Version :9

Sequence 1:NP_608864.1 Gene:tank / 33684 FlyBaseID:FBgn0031635 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_001186423.2 Gene:Ei24 / 13663 MGIID:108090 Length:340 Species:Mus musculus


Alignment Length:349 Identity:130/349 - (37%)
Similarity:198/349 - (56%) Gaps:50/349 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIKNITLGILYGLWDSIRGMTLVLHIDDEVNRQNAEQEHRQQLRRTDKDRYERARRSPSPVPSSA 67
            ::|.....:..|:.|||.|:..:..:|..:.::..||..|:                       |
Mouse     4 SVKTFLQDLGRGIKDSIWGICTISKLDARIQQKREEQRRRR-----------------------A 45

  Fly    68 AAMIREEYAKQAEENADERTLEKILGKKPAAQDQHPQGEKKIAKKLFKCCMLNGGFTWLSIVLFE 132
            ::::.:                    ::|.:.::..:.|.:|..::|:||..|||..|.|::||.
Mouse    46 SSLLAQ--------------------RRPQSVERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFY 90

  Fly   133 NALLPTLKFCLTIFYG---AHSETLPVVWGWLHPILSLLFGMMWVLPIFMLSKIVSSLWFADIAN 194
            ...:|.|:.......|   .|.:    ||.||...|:.:|..:||||:|:|||:|:::||.|||:
Mouse    91 RVFIPVLQSVTARIIGDPSLHGD----VWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIAD 151

  Fly   195 AAYRVRKGRPQLIPGISKLVADFLFSMVVQMLFLVQSMLVNLVPVKYVGSSLCFVHLCLLYSLYS 259
            .|:.|...:|...|.:||::||.||::::|.|||:|.|.|:|.|:..||..:..:|:.||||||.
Mouse   152 LAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYC 216

  Fly   260 FEYKWFNMGWELHRRLTYIEKNWPYFFGFGIPLTVLTNLSSSVIVSSCIFSIFFPLFILSGNEAK 324
            |||:|||.|.|:|:||:.||:||||:||||:||..||.:.||.|:|.|:|||.|||||:|.||||
Mouse   217 FEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAK 281

  Fly   325 PIVDTTEVSLRLFSPVVFISNLCF 348
            .........|||||.|||:||..|
Mouse   282 TPGKAYLFQLRLFSLVVFLSNRLF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tankNP_608864.1 EI24 164..296 CDD:284638 67/131 (51%)
Ei24NP_001186423.2 Interaction with BH3 domain of BCL2 52..115 17/66 (26%)
EI24 120..254 CDD:336651 68/133 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 319..340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838367
Domainoid 1 1.000 200 1.000 Domainoid score I3044
eggNOG 1 0.900 - - E1_KOG3966
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3588
Inparanoid 1 1.050 259 1.000 Inparanoid score I3119
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55407
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005680
OrthoInspector 1 1.000 - - oto93746
orthoMCL 1 0.900 - - OOG6_104073
Panther 1 1.100 - - LDO PTHR21389
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2509
SonicParanoid 1 1.000 - - X4663
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.