DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and ATGLR1.2

DIOPT Version :10

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_199651.1 Gene:ATGLR1.2 / 834895 AraportID:AT5G48400 Length:867 Species:Arabidopsis thaliana


Alignment Length:32 Identity:10/32 - (31%)
Similarity:11/32 - (34%) Gaps:6/32 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TLYTH---DHC---TLCDELVEQLEAQFAGRY 57
            |.|.|   .||   ..||........|..|:|
plant    73 TQYFHCQTGHCPQKVHCDPCHPCHPCQCYGKY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 37..418 CDD:380606 7/24 (29%)
PBP2_iGluR_putative 438..836 CDD:270435
ATGLR1.2NP_199651.1 PBP1_GABAb_receptor_plant 41..407 CDD:380645 10/32 (31%)
GluR_Plant 440..770 CDD:270404
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.