DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and grin1

DIOPT Version :10

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:XP_012825220.1 Gene:grin1 / 780048 XenbaseID:XB-GENE-494200 Length:941 Species:Xenopus tropicalis


Alignment Length:71 Identity:17/71 - (23%)
Similarity:24/71 - (33%) Gaps:23/71 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AGRYALEKVDITRKENVRFLRLYRYD--------------------IPVLFLNGQFLCMHRL--N 96
            ||.|.|.:..:...:.|..|.|...|                    ||.:.| |.......|  |
 Frog   147 AGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMIL-GHLFSQEELSGN 210

  Fly    97 ADLLQK 102
            ::|:||
 Frog   211 SELIQK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 37..418 CDD:380606 17/71 (24%)
PBP2_iGluR_putative 438..836 CDD:270435
grin1XP_012825220.1 PBP1_iGluR_NMDA_NR1 25..404 CDD:380602 17/71 (24%)
PBP2_iGluR_NMDA_Nr1 416..818 CDD:270437
CaM_bdg_C0 854..882 CDD:402271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.