DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and Ir40a

DIOPT Version :9

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a / 35449 FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster


Alignment Length:491 Identity:97/491 - (19%)
Similarity:169/491 - (34%) Gaps:146/491 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   487 EDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQRPSSP 551
            ||||    |.|..:.|.:..|...|||..||.:.:..||...|:|:  ::.|.........  :|
  Fly   293 EDGK----DSNDSFTGGIGLLQSGQADFFLGDVGLSWERRKAIEFS--FFTLADSGAFATH--AP 349

  Fly   552 SSLFKFLTVL---ETNVWLCILAAYFFTS-------FLMWIF-DRWSPYSYQNNRE-----KYKD 600
            ..|.:.|.::   :.::|..::....|:.       .|.:|: .||:....::..|     .|..
  Fly   350 RRLNEALAIMRPFKQDIWPHLILTIIFSGPIFYGIIALPYIWRRRWANSDVEHLGELYIHMTYLK 414

  Fly   601 DEEKREFNLK----------------ECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIII 649
            :...|...||                :|:||.:.....|...|.......:.:...:|:....::
  Fly   415 EITPRLLKLKPRTVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYWIAATYVL 479

  Fly   650 AS-YTANLAAFLTVSRLDTPVESLDDLAKQ-----YKILYAPLNGSSAMTYFERMSNIEQMF--- 705
            |. |:|.|.:.......:.|:.:|..|...     |: ||.....||    .|.:.|..::|   
  Fly   480 ADVYSAQLTSQFARPAREPPINTLQRLQAAMIHDGYR-LYVEKESSS----LEMLENGTELFRQL 539

  Fly   706 YEIWKDLSLNDS----LTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPAT--LDEAVARVRNST 764
            |.:.:...:||.    :.:||..                      .||.|.  .|:||       
  Fly   540 YALMRQQVINDPQGFFIDSVEAG----------------------IKLIAEGGEDKAV------- 575

  Fly   765 AATGFAFLGDATDIRYLQLTNCDLQVVGE---EFSRKPY----AIAVQQGSHLKDQFNNAILTLL 822
                   ||....:.:      ::|..|.   :.|:|.|    |:|||.|.......||.::.|.
  Fly   576 -------LGGRETLFF------NVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLF 627

  Fly   823 NKRQLEKLKEKWW-------------------KNDEALAKCDKPEDQ-SDGISIQNIGGVFIVIF 867
            ....|:|:....:                   ||.||.::.:..:.. ...::::.:.|.||.:.
  Fly   628 ESGILDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALG 692

  Fly   868 VGIGMACITLVFE----------YW-------WYRY 886
            ||...|.:.|:.|          .|       |.||
  Fly   693 VGSLAAGVILLLEIVFIKLDQARLWMLCSRLQWIRY 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378
PBP2_iGluR_putative 438..836 CDD:270435 81/421 (19%)
Lig_chan 565..870 CDD:278489 68/375 (18%)
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 17/50 (34%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/97 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 39/187 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463017
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.