DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and Ir11a

DIOPT Version :9

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:292 Identity:57/292 - (19%)
Similarity:100/292 - (34%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 DLINEIAAIVHFD---YTIQEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGSMSVMAEREIVI 529
            ||:..:|..:.|.   |..||... .||    .|..:|..::|.|....|.:|.:|...:|..:.
  Fly   279 DLLQLLAKALKFRIQLYMPQEPSQ-IFG----EGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLF 338

  Fly   530 DFTVPYYDLVGITIMMQRPSSPSSLFKFLTVLETNVW----LCILAAYFFTSFLMWIFDRWSPYS 590
            ..:..|:. ....::::|......|...:......:|    :.:|.|...|.:|           
  Fly   339 SKSTVYHQ-SNFVMVVRRDRYLGRLGPLILPFRGKLWGVIIVILLLAVLSTCWL----------- 391

  Fly   591 YQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKN-LSG----RLVAATWWLFGFIIIA 650
                         :....|...:...:|.:.   |...|.: |.|    |.:.|:|.|...::..
  Fly   392 -------------RSRLGLSHPIEDLLTVIV---GNPIPDHRLPGKGFLRYLLASWMLLTLVLRC 440

  Fly   651 SYTANLAAFLTVSRLDTPVESLDDLAKQYKILYA---------------PLNGSSAMTYFERMSN 700
            :|.|.|...|.:||.....:.|..|.|....:.|               ||:.|:.   |||:..
  Fly   441 AYQARLFDVLRLSRHRPLPKDLSGLIKDNYTMVANGYHDFYPLELTCRQPLDFSAR---FERVQR 502

  Fly   701 IEQMFYEIWKDLSLNDSLTAVER-SKLAVWDY 731
                       .:.::.||.:.. |.||.|::
  Fly   503 -----------AAPDERLTTIALISNLAYWNH 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378
PBP2_iGluR_putative 438..836 CDD:270435 57/292 (20%)
Lig_chan 565..870 CDD:278489 37/192 (19%)
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.