DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and Ir7b

DIOPT Version :9

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:470 Identity:88/470 - (18%)
Similarity:166/470 - (35%) Gaps:128/470 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 GYKGYCIDLINEIAAIVHFDYTI-------QEVEDGKFGNMDENGQWNGIVKKLMDKQADIGLGS 518
            |.:|..:..:.|     :.::|:       :||    ....||:|:   |..::....||..||.
  Fly   235 GIEGALLQFMAE-----NLNFTVGLYWMNKEEV----LATFDESGR---IFDEIFGHHADFSLGG 287

  Fly   519 MSVMAEREIVIDFT-VPYYDLVGITIMMQRPSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWI 582
            ..........|.:: ..||.:..|.::....|:.|:..|........:|..|.........|:.:
  Fly   288 FHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLLWRAIGLVLILACLLLML 352

  Fly   583 FDRWSPYSYQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGE---APKNLSGRLVAATWWLF 644
            ..||. :.::..|..|.:                :..||..|..|   .|:....|||..| |||
  Fly   353 LVRWR-HHHELPRNPYYE----------------LLVLTMGGNLEDRWVPQRFPSRLVLLT-WLF 399

  Fly   645 GFIIIAS-YTANLAAFLTVSRLDTPVESLDD-LAKQYKILYAPLNGSSAMTYFERMSNIEQMFYE 707
            ..:::.| |.:.:...|.......|.:::.: ||:.:.|..|.:|.:..:.....: ..||:.| 
  Fly   400 ATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEARILASLPEL-RPEQLVY- 462

  Fly   708 IWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTA----ATG 768
                         :|.|:|.  .:|                       |:|:...|:|    .|.
  Fly   463 -------------LEGSELQ--SFP-----------------------ALAQQSGSSARVAILTP 489

  Fly   769 FAFLGDATDIRYLQLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNNAI--------LTLLNKR 825
            :.:.|   ..|.:...:..|.:|.|....:..|..|::.|||....|..|        |....::
  Fly   490 YEYFG---YFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQ 551

  Fly   826 QLEKLKEKWWKNDEALAK------------------CDKPEDQ------SDGISIQNIGGVF-IV 865
            .:..:.||    ||::|:                  .:..|||      .:.:|::.:..:| ::
  Fly   552 YVSAVDEK----DESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLI 612

  Fly   866 IFVGIGMACITLVFE 880
            ::..:| |.:..|.|
  Fly   613 LWANLG-AVVVFVLE 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378
PBP2_iGluR_putative 438..836 CDD:270435 76/399 (19%)
Lig_chan 565..870 CDD:278489 63/346 (18%)
Ir7bNP_572410.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.