DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir25a and LOC1273165

DIOPT Version :10

Sequence 1:NP_001260049.1 Gene:Ir25a / 33683 FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster
Sequence 2:XP_061503118.1 Gene:LOC1273165 / 1273165 VectorBaseID:AGAMI1_009742 Length:1024 Species:Anopheles gambiae


Alignment Length:34 Identity:7/34 - (20%)
Similarity:18/34 - (52%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DELVEQLEAQFAGRYALEKVDITRKENVRFLRLY 76
            :|:.|:|..:...:..|...::|.::.:|...:|
Mosquito   273 EEVAEKLFQRAEVQDTLRPFELTVEQCLRLAEVY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 37..418 CDD:380606 7/34 (21%)
PBP2_iGluR_putative 438..836 CDD:270435
LOC1273165XP_061503118.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.