DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and AT1G10095

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_849630.3 Gene:AT1G10095 / 837545 AraportID:AT1G10095 Length:420 Species:Arabidopsis thaliana


Alignment Length:245 Identity:47/245 - (19%)
Similarity:82/245 - (33%) Gaps:98/245 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SQRALDLTTDALRLNPANYTVWQYRRDVLRELKADLYAELDYLTE-------VIGQNSKNYQVWH 121
            ||..|.|::|.       .|.|..|:.:|.  |.|   .|...||       ::..:.|:...|.
plant   124 SQSVLLLSSDF-------GTAWNARKLILS--KKD---HLSAFTEELRLSGLILSNSPKSESTWS 176

  Fly   122 HRRVIVEMLNDP--------SNELELTENALVNDGDAKNYHAWQHRQWA---------------- 162
            |||.|::|::..        :.|.||.|:  :.:....||.||.||.|.                
plant   177 HRRWIIKMISQSFSTLQEIITKESELVES--IGERSKMNYRAWYHRCWLVSYMTIEQVIQELNKS 239

  Fly   163 -----------------------------IRSFNLYD---------DELSFVDRLISEDQRNNSA 189
                                         ::..:.||         :||.:.:.|:.......:.
plant   240 KRWAGLHVADSSCFHYRRRLMLKILESLYVKGSSAYDKTEARKIWKEELDWNEELVERYVGREAL 304

  Fly   190 WNQR---------FFVIKHFGFTPE-----LIQRELS-YTMNRIRIIKNN 224
            |..|         :|...|...:||     ::..|:: :..|.||::.::
plant   305 WLHRRFLSLNWIMYFACNHSDASPETGESIIMNEEIAIFIDNEIRLLDSS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 47/245 (19%)
AT1G10095NP_849630.3 PPTA 157..183 CDD:279565 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.