DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and RGTA2

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001331841.1 Gene:RGTA2 / 834187 AraportID:AT5G41820 Length:687 Species:Arabidopsis thaliana


Alignment Length:351 Identity:74/351 - (21%)
Similarity:144/351 - (41%) Gaps:76/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QDDGPNPVVSIAYSQKFREVFDYMRAIIARGEKSQRALDLTTDALRLNPANYTVWQYRRDVLREL 95
            :::.|||..:.|.:.:.|.:.....:...:...::.|:.|:...|..||..||.|.|.: :..|.
plant     6 REEDPNPEETAAKALELRSLQSQFMSNHHQKIYTKEAIQLSAKLLITNPEFYTAWNYPK-LAFES 69

  Fly    96 KAD-----------LYAELDYLTEVIGQNSKNYQVWHHRRVI--------------VEMLNDPSN 135
            :.|           :..||..:...:.:|.|:|..|:||:.:              :::|||...
plant    70 RLDEDSDPSLVNSIIDEELGVVQNALERNVKSYGAWYHRKWVLSKKGHYYPSLENELQLLNDYQK 134

  Fly   136 ELELTENALVNDGDAKNYHAWQHRQWAIR-SFNLYDDELSFVDRLISEDQRN-NSAWNQRFFVI- 197
            :....::....|..::|:|||.:|::.:. :....:|||.:...:||:.... .|||:.|..:: 
plant   135 QAHQKQDDEKQDDPSRNFHAWNYRRFVVELTKTSEEDELQYTTDMISDISFTIYSAWHYRSVLVS 199

  Fly   198 -----KHFGFTP-ELIQRELSYTMNRIRIIKNNESAWNYLVGVMRQ-------------GDSGNA 243
                 |..||.| |.|:|||.|..:.|..::..:|.|.|.:.::.|             ...|:.
plant   200 SLVAKKADGFMPKETIRRELDYVHSAIFTLEEKQSGWFYYLWLLDQTVKMEIPLRFSSWPSDGSI 264

  Fly   244 LLSSYPDVVDFVEELYQAGNRSPYLLAFLID-------LYQEQALQLKASDSDQLARKVYGLCED 301
            ::.|.||       .:.|.:.:..|..|..:       ||.:||              |.|:...
plant   265 IILSGPD-------CFNASSSTTKLTTFCSESGSFPLILYFDQA--------------VSGVSSS 308

  Fly   302 MATKHDVIRRKYWQYVANHLKNQLST 327
            ..|....::...|:.|::...:|:.:
plant   309 TVTIGSELKDLVWEPVSDKKNSQVDS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 71/336 (21%)
RGTA2NP_001331841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.