DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and Ptar1

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_082484.1 Gene:Ptar1 / 72351 MGIID:1921875 Length:424 Species:Mus musculus


Alignment Length:269 Identity:55/269 - (20%)
Similarity:101/269 - (37%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NPVVSI-------AYSQKFREVFDYMRAIIARGEK----SQRALDLTTDALRLNPANYTVWQYRR 89
            :|:|.:       ::..||...:.:.:.::.|..|    .....|:|...|.|||...|.|..|:
Mouse    45 SPIVLVENKLGVESWCVKFLLPYVHNKLLLYRTRKQWLNKDELADVTCTLLLLNPDFTTAWNVRK 109

  Fly    90 DV-----LRELKADLYAELDYLTEVIGQNSKNYQVWHHRRVIVEMLND----PSN---------E 136
            ::     |..:| ||:.....||:.    .|:.:.|.|||.:::.|:.    ||:         .
Mouse   110 ELILSGTLSPIK-DLHLGKLALTKF----PKSPETWIHRRWVLQQLSQETFLPSSVAKGSLGAVP 169

  Fly   137 LELTENALVNDGDA---------KNYHAWQHRQWAIRSFNLYD-----DELSFVDRLISEDQRNN 187
            .|.|:..:..:.:.         .||:||.||.|.:::....|     ||||......|....::
Mouse   170 AERTQRIIQEEMEVCSEAAGRYPSNYNAWSHRIWVLQNVAKLDLKILLDELSSTKHWASMHVSDH 234

  Fly   188 SAWNQRFFVIK--------------HFGF-------------------TPELIQRELSYTMNRIR 219
            |.::.|.|::|              |...                   .|:|::.|:.:..:.|.
Mouse   235 SGFHYRQFLLKSLISQTTIDSAVPQHNSLKSEPKDEAAAASTEEPSVNLPQLLEEEVEFCTDLID 299

  Fly   220 IIKNNESAW 228
            ....:|:.|
Mouse   300 SYPGHETLW 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 55/269 (20%)
Ptar1NP_082484.1 PLN02789 89..>315 CDD:215423 49/225 (22%)
PPTA 180..207 CDD:279565 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.