DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and PTAR1

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001353865.1 Gene:PTAR1 / 375743 HGNCID:30449 Length:429 Species:Homo sapiens


Alignment Length:277 Identity:58/277 - (20%)
Similarity:101/277 - (36%) Gaps:92/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NPVVSI-------AYSQKFREVFDYMRAIIARGEKS----QRALDLTTDALRLNPANYTVWQYRR 89
            :|:|.:       ::..||...:.:.:.::.|..|.    ...:|:|...|.|||...|.|..|:
Human    45 SPIVLVENKLGVESWCVKFLLPYVHNKLLLYRTRKQWLNRDELIDVTCTLLLLNPDFTTAWNVRK 109

  Fly    90 DV-----LRELKADLYAELDYLTEVIGQNSKNYQVWHHRRVIVEMLNDPSNELEL---------- 139
            ::     |..:| ||:.....||:.    .|:.:.|.|||.:::.|   ..|..|          
Human   110 ELILSGTLNPIK-DLHLGKLALTKF----PKSPETWIHRRWVLQQL---IQETSLPSFVTKGNLG 166

  Fly   140 ---TENA--LVND-----GDA-----KNYHAWQHRQWAIRSFNLYD-----DELSFVDRLISEDQ 184
               ||.|  |:.:     |:|     .||:||.||.|.::.....|     ||||......|...
Human   167 TIPTERAQRLIQEEMEVCGEAAGRYPSNYNAWSHRIWVLQHLAKLDVKILLDELSSTKHWASMHV 231

  Fly   185 RNNSAWNQRFFVIKHFGF--------------------------------------TPELIQREL 211
            .::|.::.|.|::|....                                      .|.|::.|:
Human   232 SDHSGFHYRQFLLKSLISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV 296

  Fly   212 SYTMNRIRIIKNNESAW 228
            .::.:.|.....:|:.|
Human   297 EFSTDLIDSYPGHETLW 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 58/277 (21%)
PTAR1NP_001353865.1 PPTA 82..>208 CDD:332411 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.