DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and temp

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001284818.1 Gene:temp / 31212 FlyBaseID:FBgn0027296 Length:398 Species:Drosophila melanogaster


Alignment Length:324 Identity:69/324 - (21%)
Similarity:124/324 - (38%) Gaps:86/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVQPLAQDDGPNPVVSIAY-----SQKFREVFDYMRAIIARGEKSQRALDLTT------------ 72
            ::.|...:...:|||.:.:     |...:.|:|:....:....:...|..|.|            
  Fly    33 EIIPKEANCNKSPVVHVEHNLGLESWCAQHVYDHAHRTLISHRRQTTAQQLRTLQQQQQSDSLAK 97

  Fly    73 ---DALRLNPANYTVWQYRRDVLRELKADLYAELDYLTEVIGQNSKNYQVWHHRRVIVEMLN--- 131
               .||.:||...|.|..||.::::.:..:..||.:...|:....|:.:.:.:||.:....:   
  Fly    98 YLNVALLINPDVTTFWHIRRQLVQKNRLSINKELQFSALVLSIKPKSNEAFAYRRWLYSFQSADA 162

  Fly   132 -DPSNELELTENALVNDGDAKNYHAWQHRQWAIRSFN-LYDDELSFVDRLISEDQRNNSAWNQRF 194
             |..||:.:.|.|.  |..|.|||||.||||.:::.. |...||...::.:.:...:.|.::.| 
  Fly   163 IDWPNEIGICERAA--DRCASNYHAWSHRQWILQNGPCLLQSELLRTEKFMRKHISDYSCYHYR- 224

  Fly   195 FVIKHFGFTPELIQR--ELSYTMNRIRIIKNNESAWNYLVGVMRQGDSGNALLSSYPDVVDF--- 254
                     ..|:.|  |||:.:.:                  ..|.||::.|:|...::..   
  Fly   225 ---------QVLLSRAYELSFALPK------------------DSGASGSSTLASLQHLMTSYGL 262

  Fly   255 -----VEELYQAGNRSPY----------LLAFL---------IDLYQEQALQLKASDSDQLARK 294
                 .|:|  .|...|:          |::||         :.|..||.|...:.|..:|.|:
  Fly   263 ECEANAEDL--LGLLLPHVDLSSVSKQRLISFLYCCNVAANDMRLCAEQRLMYGSRDCFELHRR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 69/324 (21%)
tempNP_001284818.1 PPTA 168..195 CDD:279565 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439396
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5536
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.