DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fnta and FNTA

DIOPT Version :9

Sequence 1:NP_001260048.1 Gene:Fnta / 33682 FlyBaseID:FBgn0031633 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_002018.1 Gene:FNTA / 2339 HGNCID:3782 Length:379 Species:Homo sapiens


Alignment Length:327 Identity:157/327 - (48%)
Similarity:233/327 - (71%) Gaps:14/327 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEEYLGTD---WLAYSERSDWEDVQPLAQDDGPNPVVSIAYSQKFREVFDYMRAIIARGEKSQRA 67
            |:.::..|   ::.|.:|::|.|:.|:.|:|||||||.|.||.|||:|:||.||::.|.|:|:||
Human    52 DDGFVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERA 116

  Fly    68 LDLTTDALRLNPANYTVWQYRRDVLRELKADLYAELDYLTEVIGQNSKNYQVWHHRRVIVEMLND 132
            ..||.||:.||.||||||.:||.:|:.|:.||:.|::|:|.:|.:..|||||||||||:||.|.|
Human   117 FKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRD 181

  Fly   133 PSNELELTENALVNDGDAKNYHAWQHRQWAIRSFNLYDDELSFVDRLISEDQRNNSAWNQRFFVI 197
            ||.|||...:.|  :.|||||||||||||.|:.|.|:|:||.:||:|:.||.||||.||||:|||
Human   182 PSQELEFIADIL--NQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVI 244

  Fly   198 KH-FGFTPE-LIQRELSYTMNRIRIIKNNESAWNYLVGVMRQGDSGNALLSSYPDVVDFVEELYQ 260
            .: .|:... :::||:.||:..|:::.:||||||||.|:::  |.|   ||.||::::.:.:| |
Human   245 SNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQ--DRG---LSKYPNLLNQLLDL-Q 303

  Fly   261 AGNRSPYLLAFLIDLYQEQALQLKASDSDQLARKVYGLCEDMATKHDVIRRKYWQYVANHLKNQL 325
            ..:.||||:|||:|:| |..|:.:..:.:.:..|...|||.:|.:.|.||::||:|:...|:::.
Human   304 PSHSSPYLIAFLVDIY-EDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH 367

  Fly   326 ST 327
            ||
Human   368 ST 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FntaNP_001260048.1 PLN02789 14..314 CDD:215423 149/301 (50%)
FNTANP_002018.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 1/1 (100%)
PLN02789 64..365 CDD:215423 153/309 (50%)
PFTA 1 112..146 19/33 (58%)
PFTA 2 147..180 19/32 (59%)
PFTA 3 181..215 22/35 (63%)
PFTA 4 216..249 19/32 (59%)
PFTA 5 255..289 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145878
Domainoid 1 1.000 75 1.000 Domainoid score I9101
eggNOG 1 0.900 - - E1_COG5536
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1534
Inparanoid 1 1.050 328 1.000 Inparanoid score I2470
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54481
OrthoDB 1 1.010 - - D1527547at2759
OrthoFinder 1 1.000 - - FOG0005243
OrthoInspector 1 1.000 - - oto90770
orthoMCL 1 0.900 - - OOG6_102620
Panther 1 1.100 - - LDO PTHR11129
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3760
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.